SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005269 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005269
Domain Number 1 Region: 1-221
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.46e-84
Family Calponin-homology domain, CH-domain 0.0000013
Further Details:      
 
Domain Number 2 Region: 1660-1839
Classification Level Classification E-value
Superfamily Plakin repeat 2.62e-47
Family Plakin repeat 0.00033
Further Details:      
 
Domain Number 3 Region: 2211-2430
Classification Level Classification E-value
Superfamily Plakin repeat 2.44e-46
Family Plakin repeat 0.00049
Further Details:      
 
Domain Number 4 Region: 5961-6119
Classification Level Classification E-value
Superfamily Spectrin repeat 3.29e-30
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 5 Region: 5083-5243
Classification Level Classification E-value
Superfamily Spectrin repeat 4.12e-29
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 6 Region: 6405-6555
Classification Level Classification E-value
Superfamily Spectrin repeat 1.24e-26
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 7 Region: 2519-2638
Classification Level Classification E-value
Superfamily Plakin repeat 1.44e-25
Family Plakin repeat 0.0013
Further Details:      
 
Domain Number 8 Region: 5194-5339
Classification Level Classification E-value
Superfamily Spectrin repeat 3.96e-25
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 9 Region: 237-353
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-24
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 10 Region: 4647-4803
Classification Level Classification E-value
Superfamily Spectrin repeat 2.59e-23
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 11 Region: 6198-6339
Classification Level Classification E-value
Superfamily Spectrin repeat 2.04e-22
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 12 Region: 6617-6743,6774-6805
Classification Level Classification E-value
Superfamily Spectrin repeat 2.82e-22
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 13 Region: 6918-7000
Classification Level Classification E-value
Superfamily GAS2 domain-like 8.24e-21
Family GAS2 domain 0.00056
Further Details:      
 
Domain Number 14 Region: 5520-5679
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-20
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 15 Region: 5760-5901
Classification Level Classification E-value
Superfamily Spectrin repeat 6.48e-20
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 16 Region: 4316-4441
Classification Level Classification E-value
Superfamily Spectrin repeat 7.97e-18
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 17 Region: 6086-6191
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-17
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 18 Region: 5412-5569
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-17
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 19 Region: 3752-3895
Classification Level Classification E-value
Superfamily Spectrin repeat 9.16e-17
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 20 Region: 6829-6909
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000123
Family Polcalcin 0.057
Further Details:      
 
Domain Number 21 Region: 4862-5022
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000259
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 22 Region: 597-715
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000109
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 23 Region: 4551-4659
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000152
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 24 Region: 3668-3790
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000236
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 25 Region: 3862-4003
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000127
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 26 Region: 4223-4331
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000133
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 27 Region: 5673-5788
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000561
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 28 Region: 1595-1658
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000327
Family Plakin repeat 0.0033
Further Details:      
 
Domain Number 29 Region: 4445-4567
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000979
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 30 Region: 518-608
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000249
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 31 Region: 2421-2480
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000392
Family Plakin repeat 0.01
Further Details:      
 
Domain Number 32 Region: 1187-1272,1299-1325
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000518
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 33 Region: 3414-3520
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000955
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 34 Region: 1297-1450
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000132
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 35 Region: 4079-4187
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000269
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 36 Region: 3239-3389
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000122
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 37 Region: 2160-2235
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000141
Family Plakin repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005269   Gene: ENSMGAG00000005111   Transcript: ENSMGAT00000006001
Sequence length 7009
Comment pep:known_by_projection chromosome:UMD2:25:5148149:5234633:1 gene:ENSMGAG00000005111 transcript:ENSMGAT00000006001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DERDRVQKKTFTKWVNKHLMKVRKHINDLYEDLRDGHNLVSLLEVLSGVKLPREKGRMRF
HRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIYISGESGD
MSAKEKLLLWTQKVTAGYIGVKCTNFSSCWSDGKMFNALIHRYRPDLVDMERVQVQSNRE
NLEQAFEIAERLGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKVPEGGEGISAIEVD
SRWLEYQTRLESLISWIKQHTILMSDKSFPQNPVELKALYNQYIHFKETEIPAREQEKGR
IEELYKLLEVWIEFGRIKLPQGYHPNDVEEEWGKLIIEMLEREKLLRPAVERLELLLQIA
NKIQNGALSCEEKLTLAKNTLQADAAHLEAGQPVQYEADVVVYLQECEGLLRQLQVDVQI
LRDENYYQLEELAFRIMRLQDELVTLRLECTNLYRKGHFSTLELAPAPTLSTTQLKGESL
TKGLHTSSASWFRKPMTRTELVAISSSEDEGSLRFVYELLAWVEEMQMRLERAEWGSDLP
SVETQLETQQHIHSSVEELGSNVKEARLYEGKMSQNFRASYTETLGKLETQYCKLMETSS
FRLRHLQSLHGFVSRATAELIWLNEKEEEELAYDWSDNNPNIAAKRNYFSELTMELEEKQ
DIFRSLQDTAELLALENHPAKQTVEAYSAAVQSQWQWIKQLCLCVEQHVKENAAYFQFFS
DARESEAYLRNLQDSIRRKYSCDHSTSLTRLEDLLQDSMDEKEQLIQSKSSVASLVGRSK
SIVQLRPRNPEHLVKSTIPIKAVCDYRQIEITICRNDECVLEDNSQRTKWKVISPTGNEA
MVPSVCFLIPPPNKEAIEMANRVEQLYQKVMALWHQLHMNTKSLISWNYLRKDIALVQSF
SMEKLRSLAQGECQQALRSLQAHYEDFLQDSRDSELFSVSDRLRLEEEVESSKEHIQQLL
ESMENEDKDETVARTYLSELQNIRLRLEECEQRLVGRIQSPSSSRADGDSIQENTIRIAE
QERTQDDLQRLKSDLRCVSERCCSFLSKAPSGPSTPRLRAELDLLVTKMEQTYGLSSVYL
DKLKTVDIIIRNTQGAESLVKGYEVKLSQEEAVPADLTAIQAHRSALQQWLGEVKGKNSV
FSVLEEEPAPRSRPGEKPPASIPRSVFVLQLRAWVRLLRTSRGLGHTELESIQEVLSDYR
QCHRALIQWIEEITAQQELMKPGQAEDSRVLSEQLSQQTALAAEIEKNQAKLDQCQKFSQ
QYSAAVKDYELQLMTYRAFVESQQKSPMKRRRMLSSSDAITQEFMDLRTRYTALVTLTTQ
HVKYISDALRRLEEEEKVVEEEKQEHVDKVKELLGWAVGQGPSGPTSDPHIFSTAELSFL
LLFQQALNEELAAKKEQVSEAIKTSQIFLAKHNHKLSHQEKDQISAQVAALKDTYQALCT
DTTEQLQQLQSQLAQEAEHKTRRAGGTAGGFLQGTLPVQLHGVMRALLGSWLKEDPPKWR
LCCPTGPAGLLGAPHAPVLWVHPSCLCASCLQSFRYTSVTSQRSISPRVGLPGTLAVSPL
CPALSGRVLVAGLRSEQLSLTLSQPKSMMCPCTVCVSLQKAVQERLLPPQLYSRLLSHLE
SNKDLIDPNTAEKINLSELLQRCILHQDTGLRFLPVKQLAGGMVSLKSGRKVSIFRAVQE
GLIDRQVTVRLLEAQLFAGGIVDPRTGHRLAVDEAVRHNLIDQDLACTLLIRQLQTGGII
DAATGERLTVDEAVRKELVAPRLALVILESLRSFMGLLWPETGEVVPAAGALEQGILSTE
LAYKILRKRQLIKAVFIPETTEVLSWKKAVEHGILERDVAKKLKSMVIPDVMGSVQLASR
SSSGGHQGQRDPELRGDDEKLMFHLMTHSYINIHDGQKLLLVDGELSNLTKDLIQTQENG
SCAHPLEEDESFEETKETAVLEREPCNGVAVQQLELQLAPLQEGSKKTLPPRSTLENGEV
GMGPGRLLLDRAGDDLHVEEQGQVCTERATTRSETDARSGREQIASTADGLEDIKDQKRA
LETGAGVVKSESHLVVPICASRERLEVVAGRSGGAKEPELEAEGVGEIYFWNEETAQNGT
LGGEEAVLTRTAEAEQMECTENTASVLHVEEGPREKVLGGESVGDAALPRPSDRDGDVLE
TLQMQLQSGGILCEQMGRTLLLNEAVACGAVPGHTAVKLMEKMKMFSGFFDSHTRESLTT
EDVIEEGLMDEQLLQKVLTSDKAISGVLDPGNNFVYSVKDAAAVGLLDRETAMRLLEGQV
VTGGIVDLKRGKKVSVTLASNLGLIEPASQKELVKLEKASKGKSTDEATRQKLLRLQAET
SGIVDPKTKQPLTVAQAVERGLLEREKAFQLLTRQIAGGGILHHASGMRLSVSDAMKHDL
IDADLCNELTKAEGVCLQECTHPVTKEKLPLPRAVAAGVVSPEFQRKVQEIQAGAGSVID
PSSGQRMALSRAAQEGLLPNTKVPSQSLSPCWELQLFVFLPLPPQSTARGWHRAEQLDML
GVIDLGTVEIFPVFGAMQRGLIDQETGLVLLEAQVITSDLVLPETGEKLSLEEGLARDII
NLRTFHVLRELKDALQQVHEGGIVDASSGKRLALEEAVEKGLIGQRLAAAIREAQMSVES
DMVEALTVDKAHLSQEKMEKVSPKEEGVDLRGGAAVSDGTEHKARSKAASSPAKGGKPKL
IPTEASEQSVREQREVGEMIPGSSALRAASLSVEVVTKATGTAESSSHATKGAGGEAAEL
GQGKEGSKERRKAVVSTDGALAGGAAAASERRERVGSWERGAQVTPRESVGLGKEEVGPT
TPRGSGKADVPVKPARDKPAGGRAAGETPSLETEGPGGQEGTGEIELKAAQRQKSRKRRT
KQIGVSGDSAQLEKPVEKQSLPIPISKEIPGKEEEEDFVSRAPEAKPEAASKELPAGWAD
DAAEQKQLESSRDGKAKPIPGKDAAKLTGVQVLPTPPEAAEAAAVLRAAVRVGPPSSAAL
EMEGMLSQEEAERGTHRSSGHLHTPPQLQAAAISTDRAAVPTAPVSQGDVPRGEAAQEKP
RQAGPGDRGLLLPVIVEGELLETSSDSARPAQACVGEKPTCLIFPVVNLGDKASKWKVPE
MECYLGISSFQNYNHLFSLFSKPELLFHCRILQIKFSKKMCLEHDEKLISYLSMLRDIEM
RIKRVQPAEQNLGELQTLLQQAEALGAELRELSFPVNQELDAVKRIVANPPEEVPEQLLR
ALEKDAKNLQKSLSSASDILESRLQNLRGAAETQKAEITAHHESLQGKLQELLCWVSGTA
QALDGTDYQHTLDVSSLSRCLQRYKELSEPLADTKSQLDATAFDVQFLISEHAQDLSPQQ
SRQLLRLLNELQKAFRELAGRVTAQVEVLQVCLRQAEQTDQVKTLQEQQAARAQNLAELS
SWLAAAEDTLEEQQRAASQGDLPALQQRQSDVKELQRSMHSRAASFASVLKSTEEFLEEN
KAKMEPGELAVLQEKLQRAKEQYQSLQERTEMAQKELESAVTAAVQQETEKVKAAKELQE
NSNKIDALLSWVASLEQKGELPQYRPHPAERAGKGAEDIPDGHVVGAASTAESLDEQYEG
LKAQHRELLSQQQDVILATQAAQAFLEKHGHSLPREEGARLQGGLAELKERYAASLARSE
VQLKRVQVLRDELQKFLRDHGEFEAWLKQAEQDLEGMCKGDGDPASLRQLLLRQGSFSED
VISHKGDLRFVTMSGQKVLDAEGAAGDAGSSGSVVKSKLEDASQRYATLHSKCTKLGSHL
STLLDHYQQFQEVAESLQMWLEDSEAAVGKLLSESISSDPTALQEQLASAGQQLQGNLAE
HQVPVEKLQKAARSLLEVQGEPAPDHGHIQETTDAIVSRFQILSQQMAERSDLLQKSIAQ
SQSVQESLESLLHSVADIERSLSTEQPGTLSSATIQDSLATSAKLKQDIARQRSCLEATR
EMVTRFAETADGSTAAALQGKLAEVAERFGRLCQQQQEKEEVLKGLLPKVEQYEQLSEKL
QQFMESRARMLASGNQPEQDIAHFSQHLQELNMEMGQHQEDLAALEQLAVELGASGFVPG
AAAQQEKLQNLKEEFLQLQKVAKERERDASSCQEQLDEFRRLVAALRKWLKDSEGKVPPV
DTSLGTQELQRRRQQVPFAPAQELLEEWSGKGPQVEELSHRGTLLENLIVEITAPDSQTK
AGSVLPAVGGPLGSVNGFHTCKVDLTEIQCDVSDVSRQYEGLGAALRERLQQLSALLERM
RAVQEEAGAVLQWLESKERTLSELEASSSPTKTETVRAQAEHNKAFLAELEQNSGKIQKV
KEALSGLLEKYPDSPEAANWKKMQEDLNCRWERASQATAERQQKLEESANQLASFQAAEA
QLRPWLMEKELMMSVLGPLSIDPNMLNAQKQQVQFMLKEFESRRQQHEQLNQAAQSILTG
PGDVSPSTNHVREELQGVNQKWSELTERLNSRSSQIDQAIVKSTQYQELLQGLSEKVKAV
GQRLSNQSAVSTQPDAVKQQLEETSEIRSDLEQLEEEIAEAQTLCDDLSVLIGEQYLKDE
LRKRLETVALPLKGLEDLAADRMNRLQTALASSQQFQHMFDELRTWLDDKLCQQARSQPI
SARLERLQSQIQEQEEFQKSLNQHSGSYEMIVAEGESLLLSVQPGEEKTALQNQLVSLKT
HWEELSKQAADRHSKLKDCLQKAHKYQRHAEDLLPWVEDCKARVSELEVTLDPVQLEAAL
LRSRALLSDVEKRRSVLEMLNGAADVLIDASQSDEDDIRDEKAAINQQMDAITEELQAKT
GSIDEMSQRLKEFQESFKNIEKKLEGAKHQLEIFEALGPQACSNKNLEKLRAQQEVLQAL
EPQVDYLKHFTRGLVEDAPDGSDCSQLLGQAEVAQEEFKAMRQKVNDCCVLMENKLEGIG
QFTGRVREMFSQLADLDDELDGMGPTGRDADSLQSQAEDVRTFLGKLQGLKADIEASESE
CKKMLEDEGSPDLLGLKRELETLSKQCSKLTERGRSRQEQVETTLARVEDFYSRLKELTH
MTAAAEESEALQWVVGTEVETINQQLADFKLFQKEQVDPLQLKLQQVNGVGQGLIQSAGK
NCDVQGLEHDMEEINTRWNTLNKKVAQRIAQLQEALLRCGKFQDALEPLLSWLADTEELI
SNQKPPSAEYKVVKAQIQEQKLLQRLLDDRKATVEMIQAEGGRIAQSAEPADREKISGQL
QSLESRWAALLCRAAGRQKQLEDILVLAKQFHETTEPVSDWLSVTEKKLANSEPIGTQTT
KIQQQISRHKALNEEIVNRKKNVDQAIRNGQALLKQTTGEEVLLIQEKLDGIKTRYSDIT
AASSKALRTLEQARQLATKFQSTHEELNAWMSKVEDELASSGGQSPASEQIPQFQQRQKE
LKKEVMEQRLVLDTVNEVSRALLELVPWRAREGLDKLVSDTNERYRLVSDTVRQRVEEID
AAIQRSQQYEQAADAELAWVAETKRKLMALGAIRLEQDQTTAQLQVQKAFSIDIIRHKDS
MDELFSQRNEIFGTCGEEQKAVLQDKTESLVQQYEAVSQLNSERYARLERAQVLVNQFWE
TYEELSPWIEETQTLISQLPPPAIDHEQLKQQQERDAKQLRESIAEHKPHIDKLLKIGPQ
LKDLNPEEGEMVQKKYSAAEAMYAKIKEEVCQRALALDEAVSQSTQFHDKIEPMLETLDA
LSSRLRVPPLIPAEVDKIRECISENKNATVELEKLQPSFEALKRRGEELVGRSQGADKDL
AAKVIQDKLDQMVFFWEDIKARAEEREMKFLDVLELAEKFWYDMAALLTTIKDTQDIVHD
LESPGIDPSIIKQQVEAAETIKEETDGLHEELEFIRLLGTDLIFACGETEKPEVKKSIDE
MNNAWENLNKTWKERLEKLEEAMQAAVQYQDTLQAMFDWLDNAVIKLCNMSPVGTDLNTV
KEQMNEMKEFKMEVYQQQIEMEKLNHQGELMLKKATDETDRDIIKEPLTELKHLWENLGE
KIAHRQHKLEAALLALGQFQHALAELMAWLTHTEELLDAQKPINGDPKVIEVELAKHHVL
KNDVLAHQATVETVNRAGNELLESSAGDDASSLRNRLEGLNACWEAVLQKTEEREQQLQS
TLQQAQGFHGEIEDFLLWLTRMESQLSASKPTGGLPETAREQLNAHMELYGQLKAQEDVY
SQLLAKGRLMLLNRDDSSAGSKTEQSVALLEQKWCLVSTKMEERKAKLEEALALATDFQN
SLQDFINWLTLAEQSLNIVPPPSLILNAVLAQIDEHKVFANEVNAHRDRIIELDQTGNQL
KFLSQKQDVVLIKNLLVSVQSRWEKVVQRSVERGRALDDARKRAKQFHEAWKKLIDWLED
AENHLDSELEISNDPDKIKLQLSKHKEFQKTLGGKQPVYDTTIRTGRALKEKALLPDDTQ
KLDNLLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAEDQP
VHGDLDLVMNLMDAHKVFQKELGKRTGTVQVLKRSGRELIENSRDDTTWVKVQLQELSNR
WDTVCKLSVSKQSRLEQALKQAEEFRTAVHMLLEWLSEAEQSLRFRGALPDDAEALQSLI
DVHKEFMKKVEEKRVDVNAAVGMGEVILSACHPDCITTIKHWITIIRARFEEVLTWAKQH
QQRLEAALSELVANAELLEELLAWIQWAETTLIQRDQEPAPQNIDQVKALIAEHQSFMEE
MTRKQPDVDRVTKTYKRKATEPPHGALIDKSRSNSTCCGKSLTQAAPPTMPIISQSETKN
PRINQLSARWQQVWLLALERQRKLNDALDRLEELCPELKEFANFDFDVWRKKYMRWMNHK
KSRVMDFFRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEF
VAALHPNKDAYRPTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFFLGNQFGDSQQ
LRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNLELREKFILP
Download sequence
Identical sequences G1N1A8
ENSMGAP00000005269 ENSMGAP00000005269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]