SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005326 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005326
Domain Number 1 Region: 301-631
Classification Level Classification E-value
Superfamily L domain-like 8.84e-40
Family Ngr ectodomain-like 0.05
Further Details:      
 
Domain Number 2 Region: 680-829
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.97e-33
Family Toll/Interleukin receptor TIR domain 0.000085
Further Details:      
 
Domain Number 3 Region: 37-255
Classification Level Classification E-value
Superfamily L domain-like 2.12e-31
Family Ngr ectodomain-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005326   Gene: ENSMGAG00000005422   Transcript: ENSMGAT00000006059
Sequence length 842
Comment pep:known chromosome:UMD2:19:3636855:3641293:1 gene:ENSMGAG00000005422 transcript:ENSMGAT00000006059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSRAAPIAQTLRVLLRLLLVLSLLAGCIPSPCLEVIPSKAFRCTGQNISGVPAEIPNTT
LDLDLSFNNLQSLNSNHFSSVPELQLLDLSRCHIHTIEDNTFVDLHNLSTLILTANSLQH
LGLAAFYGLTSLKKLVLVETNISSLSDLPIGHLNTLQELNLGHNNIASLKLPKYFANLTS
LRHLSFSSNNITYISKGDLDALRETNRLNLTLVLSLNNIKYIQSGSFAKIHLGELVLRSS
FENLSVMHSSLQGLAGLQVNRLIVGEFSNILKMKAFQNGLLSGLCQVQMQEFVLMCFREF
ENDTDTLFDCISNVSTIRLVDLNLETLSEVPVFSQVKHLEWKKCRFQKLPAEKLSLFKEL
RVLRITKSKDLNSFEQNFGTLTYLEVIDLSENRLSFLTCCSPKFPRSPNLKHLNLSFNSD
ISLTGDFANLRNLLYLDLQHTKLIHHGTYPVFLLLQKLIYLDISHTKTHVISHHIFHGLN
SLQVLKMAGNSFENNTLTNHFENVRRLRILDISSCKLVWVVQSTFNALSELKELIISNNK
LLTFDPVTYKPLQALTALDFSNNQLTFLSDSALEILPDSLVLLDISHNLFECSCIHLNFL
KWVKEKQGLLQNKHSMICHTPAYMKNVSLLDFDMSSCHPNPTTVACSVTVLLAAGVFLFF
IYKYYFQLYYSVVLLSGCKHSAERGDTYDAFVIHSSKDQEWVMKELVGPLEEGKPPFQLC
LYYRDFLPGVPIVTNIIQEGFLSSRNVIAVISADFLESKWCSFEFDIAQSWQLVEGKAGI
IMIVLGEVDKTLLRQRLGLSRYLRRNTYLEWKDKEISKHIFWRELTSVLLEGKWNHEEIK
LM
Download sequence
Identical sequences G1N1E9
ENSMGAP00000005326 ENSMGAP00000005326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]