SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005604 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005604
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.48e-50
Family Calponin-homology domain, CH-domain 0.000000398
Further Details:      
 
Domain Number 2 Region: 200-262
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 6.41e-22
Family EB1 dimerisation domain-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005604   Gene: ENSMGAG00000005665   Transcript: ENSMGAT00000006344
Sequence length 269
Comment pep:known_by_projection scaffold:UMD2:GL425408.1:220:1798:1 gene:ENSMGAG00000005665 transcript:ENSMGAT00000006344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVNVYSTSVTSENLSRHDMLAWVNDSLQLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRK
VKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIAVERLVKGKFQDNFEFIQWFKKFFDANYD
GKEYNPLLARQGQDAAPAPNPGDHSFNKPKKLIGTAVPQRTSPTGPKNTQHPARLGNVPT
GILRKNSPATRNGGPEADAQILELNQQLMDLKLTVDGLEKERDFYFSKLRDIELICQEHE
NENSPIISGIVSVLYATEEGFAPPEDDEL
Download sequence
Identical sequences H9H0V7
ENSMGAP00000005604 ENSMGAP00000005604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]