SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005609 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005609
Domain Number 1 Region: 387-622
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.82e-35
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 
Domain Number 2 Region: 85-241,386-437
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.44e-19
Family FAD/NAD-linked reductases, N-terminal and central domains 0.078
Further Details:      
 
Domain Number 3 Region: 1001-1033
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000452
Family LIM domain 0.0093
Further Details:      
 
Domain Number 4 Region: 1034-1063
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000591
Family LIM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005609   Gene: ENSMGAG00000005642   Transcript: ENSMGAT00000006349
Sequence length 1126
Comment pep:known_by_projection chromosome:UMD2:5:7674576:7726800:-1 gene:ENSMGAG00000005642 transcript:ENSMGAT00000006349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGENDDEKYSQAGQIFENFVQATTCKGTIQAFNILTRQLELDPLDCKNFYSKLKSRVTTW
KAKALWNKLDKRASHKEYKRGKCCMNTKCLIIGGGPCGLRTAIELAFLGAKVVVVEKRDT
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEIHVN
LEFVKVLEPPEDQENQKIGWRAEFLPVDHPLSEYEFDVIIGADGRRNTLEGFRRKEFRGK
LAIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDSTHYFV
MTAKKQSLLDKGVIINDYIDTELLLCGENVNQSNLLSYAREAADFATNYQLPSLDFAINH
YGQPDVAMFDFTSMYASENAALVRERHRHQLLVALVGDSLLEPFWPMGTGCARGFLAAFD
TAWMVRSWAQGKPPLEILAERESIYRLLPQTTPENINKNFDQYTIDPGTRYPNLNSSCVR
PHQVKQLYVTNELQQCSLERASSIRRSVNLSRRESDIRPNKLLTWCQKQTEGYRNVNITD
LTTSWKSGLALCAIIHRFRPDLIDFDALNEEDIVKNNQLGFDVAEREFGIPPLTTGKEVG
SAEEPDKLSMVMYLSKFYELFRGTPLRTVADAGDKQNGESNELCSAKSSNFIFNNYINLT
LPRKRVPKVEGKTEEKETNKRRRKGLFGVFEETSGFSSQETSVGKEQNDGREGINQNKVK
SMATQLLAKFEENAPNTIFRRQKLYKEQIDRPAQLSSESPVNPRFAQPKDTSRLLPQPKS
PSVSQFQVVARPEHEVRETKQSLNGSDHMARTPKAIEKTDIQRSLSETSENLASACSAAF
VLSGVLERLQHLDEKMKQKRAQTIANREFHKKNIKEKAAHLASLFGYMDFPKNKLPTKGL
SHSQPPTPSCPPPHDSAAASSPSSVGSASPVLPSRQNPNLCFLHHVNHVETLHQQMTVGK
VSRAIGAMAEVLVNLYVNDHRPKSQIPPLELGSLRKEFPQSIGGSDICYFCKKRVYVMER
LSAEGHFFHRECFKCEICSTTLRLGIYAFDVEEGKFYCKPHFTHCKISNKHRKRRATLQV
QCKETWKKEELRATETTTDSTLTTASSPEDRSPVQFIIPVLHPLTG
Download sequence
Identical sequences G1N204
ENSMGAP00000005609 ENSMGAP00000005609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]