SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006305 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006305
Domain Number 1 Region: 186-393
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-50
Family DBL homology domain (DH-domain) 0.000000293
Further Details:      
 
Domain Number 2 Region: 4-227
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.02e-41
Family Calponin-homology domain, CH-domain 0.0051
Further Details:      
 
Domain Number 3 Region: 380-542
Classification Level Classification E-value
Superfamily PH domain-like 3.04e-34
Family Pleckstrin-homology domain (PH domain) 0.0056
Further Details:      
 
Domain Number 4 Region: 640-768
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-26
Family SH2 domain 0.00063
Further Details:      
 
Domain Number 5 Region: 781-843
Classification Level Classification E-value
Superfamily SH3-domain 4.33e-22
Family SH3-domain 0.00071
Further Details:      
 
Domain Number 6 Region: 594-661
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000868
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006305   Gene: ENSMGAG00000006230   Transcript: ENSMGAT00000007053
Sequence length 849
Comment pep:known_by_projection chromosome:UMD2:10:12934517:13088658:-1 gene:ENSMGAG00000006230 transcript:ENSMGAT00000007053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IACWVQCGQWLISCKVLPPNHRVTWDTAQVFDLAQTLRDGVLLCQLLNNLRSHSINLKEI
NLRPQMSQFLCLKNIRTFLSACCEIFGMKKSELFEAFDLFDVRDFGKVIETLSKLSRTPI
AIGTGIRPFPTEESVDDEDVYKCLPDLIDETGVDEDEELYDCVYGEDEGGEVYEDLMKDE
AAQQPEKKHTENDVRSCCLAEIKQTEEKYTETLESIEKFFMVPLKRFLSASEFETVFINI
PDLVKIHRSLTQDISDSIINKNDQNLYQIFISYKERLVIYGQYCSQVETAISCLDNISKT
KEDVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPMEKTNLKLAL
DAMKDLAQYVNEVKRDNETLREIRQFQLSIENLNHSLLQYGRPQGDGEIRITTLDKRARQ
DRHIFLFDLAVIVCKRRGDNYEMKEIIDLQKYKITNNPTTDKENKKWSYGFYLIHIQGQN
GLEVYCKTKDLKKKWLEQFQMALSNIRPDYADTSFHEFKMHTFSRVTSCKVCQMLLRGTF
YQGYLCSKCGAGAHKECLGRLDNCGRANSGGKRKMKKDKMSIRGKKKQQNNKLNSGLPRM
QVIRNYKGIPQPAPQDGPPLHIQIGDTIELITGDAHSLFWQGRNLTTGELGFFPKREITP
LVVPKPVDYSSQLWFAGAMERLQAESELINRINSTYLVRHRTKESGEYAISIKYNNEVKH
IKILTRDGYFHIAENRKFKNLMELVDYYKHHSLKEGFRSLDTTLQFPYKESENHKCISSH
PVLSPKVIGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPSTY
VEEDAAAFC
Download sequence
Identical sequences G1N3K5
ENSMGAP00000006305 ENSMGAP00000006305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]