SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006529 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006529
Domain Number 1 Region: 92-121
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000678
Family LIM domain 0.01
Further Details:      
 
Domain Number 2 Region: 56-88
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000998
Family LIM domain 0.0034
Further Details:      
 
Domain Number 3 Region: 28-56
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000829
Family LIM domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006529   Gene: ENSMGAG00000006508   Transcript: ENSMGAT00000007282
Sequence length 163
Comment pep:novel chromosome:UMD2:5:9906790:9918691:1 gene:ENSMGAG00000006508 transcript:ENSMGAT00000007282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLSECPVTPLFGCIAGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCAC
CDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDC
FACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGSFESQVQ
Download sequence
Identical sequences G1N425
ENSMGAP00000006529 ENSMGAP00000006529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]