SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006617 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006617
Domain Number 1 Region: 36-115
Classification Level Classification E-value
Superfamily EF-hand 2.23e-20
Family Calmodulin-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006617   Gene: ENSMGAG00000006595   Transcript: ENSMGAT00000007372
Sequence length 131
Comment pep:known_by_projection scaffold:UMD2:GL425849.1:11:1571:1 gene:ENSMGAG00000006595 transcript:ENSMGAT00000007372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSMDAMGRRTARKDAGDPHTASTKAYSPFLNMVFGKERELSPEELDELLDAFKEFDTDQD
GFISYKDLGACMRTLGYMPTEMELIEISQHIKMRMGGRVDFEDFVQMMGPKLREETAHMV
GVRELKIAFRE
Download sequence
Identical sequences H9H119
ENSMGAP00000006617 ENSMGAP00000006617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]