SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006732 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006732
Domain Number 1 Region: 2-227
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.83e-77
Family Calponin-homology domain, CH-domain 0.0000824
Further Details:      
 
Domain Number 2 Region: 1287-1399
Classification Level Classification E-value
Superfamily E set domains 2.4e-36
Family Filamin repeat (rod domain) 0.00000507
Further Details:      
 
Domain Number 3 Region: 1198-1309
Classification Level Classification E-value
Superfamily E set domains 9.34e-34
Family Filamin repeat (rod domain) 0.00000446
Further Details:      
 
Domain Number 4 Region: 1401-1509
Classification Level Classification E-value
Superfamily E set domains 1.4e-33
Family Filamin repeat (rod domain) 0.00000674
Further Details:      
 
Domain Number 5 Region: 1487-1592
Classification Level Classification E-value
Superfamily E set domains 6.67e-32
Family Filamin repeat (rod domain) 0.0000169
Further Details:      
 
Domain Number 6 Region: 1584-1689
Classification Level Classification E-value
Superfamily E set domains 2.67e-30
Family Filamin repeat (rod domain) 0.00000487
Further Details:      
 
Domain Number 7 Region: 1019-1109
Classification Level Classification E-value
Superfamily E set domains 4.14e-30
Family Filamin repeat (rod domain) 0.00000338
Further Details:      
 
Domain Number 8 Region: 702-826
Classification Level Classification E-value
Superfamily E set domains 1.67e-28
Family Filamin repeat (rod domain) 0.00055
Further Details:      
 
Domain Number 9 Region: 1799-1894
Classification Level Classification E-value
Superfamily E set domains 4.8e-28
Family Filamin repeat (rod domain) 0.0000141
Further Details:      
 
Domain Number 10 Region: 625-735
Classification Level Classification E-value
Superfamily E set domains 1.66e-27
Family Filamin repeat (rod domain) 0.00067
Further Details:      
 
Domain Number 11 Region: 809-925
Classification Level Classification E-value
Superfamily E set domains 3.94e-27
Family Filamin repeat (rod domain) 0.00042
Further Details:      
 
Domain Number 12 Region: 242-354
Classification Level Classification E-value
Superfamily E set domains 6.67e-27
Family Filamin repeat (rod domain) 0.00091
Further Details:      
 
Domain Number 13 Region: 1113-1221
Classification Level Classification E-value
Superfamily E set domains 8.01e-27
Family Filamin repeat (rod domain) 0.0000168
Further Details:      
 
Domain Number 14 Region: 2173-2266
Classification Level Classification E-value
Superfamily E set domains 9.34e-27
Family Filamin repeat (rod domain) 0.0000089
Further Details:      
 
Domain Number 15 Region: 1981-2076
Classification Level Classification E-value
Superfamily E set domains 2.87e-26
Family Filamin repeat (rod domain) 0.00000402
Further Details:      
 
Domain Number 16 Region: 518-621
Classification Level Classification E-value
Superfamily E set domains 6.11e-26
Family Filamin repeat (rod domain) 0.00015
Further Details:      
 
Domain Number 17 Region: 2494-2584
Classification Level Classification E-value
Superfamily E set domains 4.67e-25
Family Filamin repeat (rod domain) 0.0000138
Further Details:      
 
Domain Number 18 Region: 2365-2456
Classification Level Classification E-value
Superfamily E set domains 6.67e-25
Family Filamin repeat (rod domain) 0.0000158
Further Details:      
 
Domain Number 19 Region: 2272-2363
Classification Level Classification E-value
Superfamily E set domains 1.47e-23
Family Filamin repeat (rod domain) 0.0000139
Further Details:      
 
Domain Number 20 Region: 342-441
Classification Level Classification E-value
Superfamily E set domains 2.74e-22
Family Filamin repeat (rod domain) 0.0013
Further Details:      
 
Domain Number 21 Region: 2093-2188
Classification Level Classification E-value
Superfamily E set domains 8.01e-22
Family Filamin repeat (rod domain) 0.0000397
Further Details:      
 
Domain Number 22 Region: 933-1033
Classification Level Classification E-value
Superfamily E set domains 4.34e-19
Family Filamin repeat (rod domain) 0.00096
Further Details:      
 
Domain Number 23 Region: 1890-1979
Classification Level Classification E-value
Superfamily E set domains 6.67e-19
Family Filamin repeat (rod domain) 0.00000819
Further Details:      
 
Domain Number 24 Region: 1738-1814
Classification Level Classification E-value
Superfamily E set domains 7.34e-16
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006732   Gene: ENSMGAG00000006582   Transcript: ENSMGAT00000007488
Sequence length 2585
Comment pep:known_by_projection chromosome:UMD2:14:9254080:9323528:1 gene:ENSMGAG00000006582 transcript:ENSMGAT00000007488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DAPWKRIQQNTFTRWCNEHLRCVNKRIGNLQHDLSDGLRLIALLEVLSQKRMYRKYHQRP
TFRQMQLENVSVALEFLERESIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPVWED
EGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAPGLCPDWETWD
PSKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKP
KLNPKKARAYGRGIEPHGNMVKQPAIFTVDTISAGQGDLMVFVEDPEGNREEAKIMPSSD
KNKTYSVQYMPKVTGPHKVSVLFAGQHISKSPFEVNVDKAQGDASKVTAKGPGLEATGNI
ANKPTYFDLYTAGAGVGDVIVEVEDPQGRCLAEVAVEDKGNQVYRCVYKPVQAGPHVVKV
TFAGEAIPKTPCNVLIGEGCSPKAAGHGQWLGRLHICFPSYYNIKTCAESSAVVALSQHL
TKAVPSWLGCIDLLFYCQGLQQAEQTKYLTLRICCAKRNPFEVHIGHEAGPQKVRAWGPG
LHEGIVGKSADFVVESIGTEVGSLGFAIEGPSQAKIECDDKNDGSCDVKYWPKEPGEYAV
HIMCDDEDIKDSPYMAFIRPASGDFNPDKVRAYGPGLERSGCIVNNLAEFTVETKDAGKA
PLKIYAQDGEGNPIDIQMKSKPDGVFACSYVPVKPIKHTISIVWGGANVPNSPFRVLIGQ
GSHPQKVKVFGPGVERTGLKASEPTHFTVDCTDAGEGDVSVGIKCDARVVSDEEEDIDFD
IIHNANDTFTVKYAPPAAGRYTIKVLFAGEEIPASPFRVKVDPSHDASKVKAEGPGLSKT
GVENGKPTHFTVFTKGAGKAPLDVQFSSPVSGEVVADVDIIDNYDYSHTVRYTPIQQGPV
KVLVTYGGDPIPKSPFTVGVAAPLDLSKVKVNGLENRVEVGKDQEFVIDTRGAGGQGKLD
VNISSPMRKAVPCLVEPVLGKECSTAKYIPREEGLYVVDVSYDGNPIPGSPYTVEATLPP
DPSKVKAHGPGLRGGLVGKPAQFTIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVS
YLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDVSKVIATGPGLERGKVGEAGLLNVDC
TEAGPGNLRVDIVSDTGSKAEIQIDDNKDGTYVVTYVPLSAGMYTIKMKYGGEQVPKFPA
RVKVEPAVDTSRVKVFGPGVEGKDVFREATTEFTVDARPLTKAGGDHIRTQITSPSGSPT
DCQIQDNADGTYAVEYTPFEKGPHTVSVTYDGVPVPNSPFRVNVTEGCHPSRVKAQGPGL
KEAFTNQPNAFSVVTRGAGIGGLGITVEGPSESKISCKDNKDGSCSAEYVPYVPGDYDVN
ITYGGEHIPGSPFKVPVKDVVDPSKVKIAGPGLGTAVRAKIPQSFTVDTSKAGAAPLEVV
VAGPRGIVEPVNVVDNGDGTHTVVYTPTQEGPYMISVKYADEEIPRSPFKVKVLPTYDAS
KVTASGPGLSSYGIPASLPVEFAVDAKDAGQGLLTVQITDQEGKPKRVDIHDNKDGTYTV
TYVPDKTGRYTIGVKYGGDDIPSSPYRIRASPAGDASKCLATGPGIAPTVRTGEEVGFVV
DAKSAGKGKVTCTVLTPDGTEAEADVVENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNS
PFTVMAVDADDAAVRSQETVGASPPGFRPWVTEEAYVPVGDMNGMGFRPFDMVIPFAVRK
GEITGEVHMPSGKTDTPDIVDNKDGTVTVRYAPTEVGLHEMHIKYMGNHIPESPLQFYVN
YPNSGSVSAYGPGLIYGVANKPATFTIVTEDAEEGGLDLAIEGPSKAEISCIDNKDGTCT
VTYLPTLPGNYSILVKYNDKHIPGSPFTAKITDDNRRRSQVKLGSAAEFLLDINETDLSL
LTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVPNSPVTIMVVQS
EIGDARRARVYGRGLVEGRTFEMCDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTC
KVSYFPTVPGVYIVSTKFADEHIPGSPFTVKISGEGRVKESITRTRRAPSVATVGSICDL
NLKIPEIDCGDMTAQVTSPSGRNSDAEIVEVDKNTYCVRFVPQEMGVHTVDVKYRGQPVP
GSPFQFTVGPLGEGGAHKVRAGGPGLERGETGVPAEFSIWTREAGAGGLSIAVEGPSKAE
IAFEDHKDGSCGVSYIVQEPGNYEVSIKFNDEHIPESPYLVPIIAPSDDARRLTVTSLQE
SGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGIHSI
DVKFNGSHVVGSPFKVRVGEPGQAGNPTLVTAYGPGLESGTTGLQSEFFINTTKAGPGTL
SVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLIGVKYGGPNHIVGSPFKAKVTGQRLV
TLGSANETSSIMVESVTRSSTETCYSAIPKSTSDASKVVSRGAGLSKAFVGQKSSFSVDC
SKAGSNMLLVGVHGPTIPCEEVSIKHLGNHQYNVTYVVKERGDYVLAVKWGDEHIPGSPF
HVTVP
Download sequence
Identical sequences G1N4G8
ENSMGAP00000006732 ENSMGAP00000006732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]