SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006863 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006863
Domain Number 1 Region: 187-389
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-52
Family DBL homology domain (DH-domain) 0.00000131
Further Details:      
 
Domain Number 2 Region: 2-212
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.24e-35
Family Calponin-homology domain, CH-domain 0.0032
Further Details:      
 
Domain Number 3 Region: 376-538
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-33
Family Pleckstrin-homology domain (PH domain) 0.005
Further Details:      
 
Domain Number 4 Region: 656-757,805-831
Classification Level Classification E-value
Superfamily SH2 domain 7.69e-25
Family SH2 domain 0.00088
Further Details:      
 
Domain Number 5 Region: 559-649
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-16
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 6 Region: 758-833
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000048
Family SH3-domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006863   Gene: ENSMGAG00000006722   Transcript: ENSMGAT00000007625
Sequence length 837
Comment pep:known_by_projection chromosome:UMD2:19:7256337:7354566:-1 gene:ENSMGAG00000006722 transcript:ENSMGAT00000007625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLPGSIDLKDIN
FRPQMSQFLCLKNIRTFLKVCHDKFGLRNSDLFDPFDLFDVRDFGKVISAVSRLSFHSIA
QTKGIRPFPSEETTENDDDVYRSLEELADEHDLGDIYDCVPCEDEGDDIYEDIIRVEVQQ
PMKMGMTEDDKRNCCLLEIQETEAKYYKTLEDIEKNYMNPLKLVLTPQDMEAIFINLEDL
IKVHFNFLRAIDVSMMSGGSSLAKVFLEFKERLLIYGKYCSHMEYAQNTLNHLIANRDDV
RQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSSDRPEKQQLKEALEAMQ
DLAMYINEVKRDKETLKKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDRYL
FLFDKVVIVCKRKGYNYELKEIIELLFHKMTDDPMNNKDIKKWSYGFYLIHLQGKQGFQF
FCKTEEMKRKWMEQFEMAMSNIKPEKANANHHSFQMYTFEKTTNCKACKMFLRGTFYQGY
LCPKCGAGAHKECLEIIPPCKMGSSADQDLLSAGPGPKMVAVQNYHGNPAPPGKPVLTFQ
IGDVIELLRGDPDSPWWEGRLLQTKKSGYFPSSSVKPCPVDARPPNSRPPSREIDYTVYP
WFAGNMERQQTDNLLKAHVSGTYLIRERPAEAERFAISIKFNEEVKHIKVVEKDNWIHIT
EAKKFESLLELVEYYQNHSLKESFKQLDTTLKYPYKSRERSTSRTFTRSPVFTPRVIGTA
VARYNFAARDMRELSLREGDVVKIYSRIGGDQGWWKGETNGRVGWFPSTYVEEEGVQ
Download sequence
Identical sequences G1N4R7
ENSMGAP00000006863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]