SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007434 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007434
Domain Number 1 Region: 7-178
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000015
Family Nucleotide and nucleoside kinases 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007434   Gene: ENSMGAG00000007325   Transcript: ENSMGAT00000008208
Sequence length 185
Comment pep:known chromosome:UMD2:12:10595521:10676475:-1 gene:ENSMGAG00000007325 transcript:ENSMGAT00000008208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVFPNCSIIHQNEMFQPQDEIEVEDGFKQYDVISALDMEAMMSTISAWIKNPVKFERSHG
INNTLDAQISPDREGGDEVIHILIIEGFLLYTYRPLIDVFHHRYFLSIPYEECKRRRSSR
NYTVPDPPGLFDGHVWPMYVKHRKIMEDLGVDVVHLNGTKSKEELFNEVYGQIQNKIEEL
LNMQK
Download sequence
Identical sequences G1N5Z5
ENSMGAP00000007434 ENSMGAP00000007434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]