SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007609 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007609
Domain Number 1 Region: 549-1024
Classification Level Classification E-value
Superfamily Ras GEF 5.89e-139
Family Ras GEF 0.0000000000000393
Further Details:      
 
Domain Number 2 Region: 5-159
Classification Level Classification E-value
Superfamily Histone-fold 1.23e-50
Family TBP-associated factors, TAFs 0.00000054
Further Details:      
 
Domain Number 3 Region: 180-382
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-42
Family DBL homology domain (DH-domain) 0.00000000525
Further Details:      
 
Domain Number 4 Region: 400-556
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-38
Family Pleckstrin-homology domain (PH domain) 0.000000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007609   Gene: ENSMGAG00000007473   Transcript: ENSMGAT00000008388
Sequence length 1313
Comment pep:known_by_projection chromosome:UMD2:2:16431653:16468257:-1 gene:ENSMGAG00000007473 transcript:ENSMGAT00000008388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WRRLELNAVGMVQVQVHPKLSSTEDALQYVEELILQLLNMLCQAQPRSFLDVEDRVQKSF
PHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGYKIDHQVSVYIVAVLEYIS
ADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDVEDLSALTLSDEEPSTSGE
QTYYDLVKSFMAEVRQYIRELNLIIRVFREPYASNSKLFSSHDVENIFSRISDIHELSVK
LLGHIEDTVEMTDEGSPHPLVGSCFEDMAEELAFDPYESYAQDILRPGFHDHFLSQLSKP
GAAFYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDEEDKECLKQAIT
ALLNLQSSMERICSKSLAKRRLSESACRFYTQQMKGKQLAIKKMNEIQKNIDGWEGKDIG
QCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRLPGASNAEYRLKEKFFMRK
VQINDKDDTNEYRHAFEIILKDENSVIFAAKSAEEKNNWMAALISLQYRSTLERMLDVTM
LQEEKEEQMRFPNPELYRFAEPDSEENIVFEENMQPKSGIPIIKAGTVVKLIERLTYHMY
ADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADRIAMENGDQPLSAELKRFR
KEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRLEEFIGTVRGKAMKKWVESITKIIN
RKKQAQAIGPSHNITFESPPPAIEWHISKPGHTETFDLLTLHPIEIARQLTLLESDFYRA
VQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVETENLEERVIVVSRIIEI
LQVFQELNNFNGVLEIVSAMNSAAVYRLDHTFEQIPSRQKKILEEAYELSEDHYKKYLAK
LRSINPPCVPFFGIYLTNILKTEEGNPEFLKRHGKELINFSKRRKVAEITGEIQQYQNQP
YCLRVEFDIRRFFENLNPMGSSMETEFTDYLFNKSLEIEPRNVKPPPRFPKKYNYPLKSP
GVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETETTASAPNSPRTPLTPPPASATSST
TDACSVFDSDPSSPFHASKTMLSLLNMQGSSYFMVCFHFTKTSDEAHVPPPVPPRRRPES
APAESSPSKITSAHLDSPPAIPPRQPTSKVYSPRYSVPDRTCISDPPESPPVLPPREPVR
TPDVFSSSPLHLQPPPLGRKSELGNTFFPNSPSPFTPPPPQTPSPHVARRHLPSPPLIQQ
DVDLHSVAGPPVPPRQSTSQHIPKLPPKTYKREHTHPSMHRDGPPLLQNAHSS
Download sequence
Identical sequences G1N6C2
ENSMGAP00000007609 ENSMGAP00000007609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]