SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007617 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007617
Domain Number 1 Region: 3-121
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.7e-48
Family Calponin-homology domain, CH-domain 0.000000341
Further Details:      
 
Domain Number 2 Region: 177-235
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 9.81e-21
Family EB1 dimerisation domain-like 0.0000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007617   Gene: ENSMGAG00000007478   Transcript: ENSMGAT00000008396
Sequence length 249
Comment pep:known_by_projection chromosome:UMD2:22:11125574:11218156:1 gene:ENSMGAG00000007478 transcript:ENSMGAT00000008396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTSDNLSRHDMLAWINESLQLTLTKIEQLCSGAAYCQFMDMLFPGSVALKKVKFQAKLEH
EYIQNFKVLQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKEYDPVAA
RQGQETMAPNLVAPVVNKPKKPLAPQRPIVAQRTPATPKGSTGMVKKAAGDDESAGLIEQ
INVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVEILYATDEGFVIPDEG
APQEEQEEY
Download sequence
Identical sequences G1N6C8
ENSMGAP00000007617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]