SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008161 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008161
Domain Number 1 Region: 1010-1124
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.97e-28
Family Calponin-homology domain, CH-domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008161   Gene: ENSMGAG00000007963   Transcript: ENSMGAT00000008950
Sequence length 1125
Comment pep:known_by_projection chromosome:UMD2:17:8903168:8957046:-1 gene:ENSMGAG00000007963 transcript:ENSMGAT00000008950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKASRSVGSVPKVPGVNKTQTTEKTKPESGSSLSAVTKLSKPGTSASLLKTKSNDDLLA
GMASGSGVTMTNGVKAKKSTCASTVSSATGTTMNTLENKPKTVAGRCSTAKRSTSSGTKE
SSSSRERIRDRSRLSQSKKLPVAGQGSSDTVLAKRSRSRTNPESDIRMSKSKSDNQISDK
AALEAKVNDLLTLAKTKDVEILHLRNELRDMRAQLGLNEDQVEGDEKSEEKEAIVVHQPT
DVESTLLQLQEQNTAIREELNQLKNENRMLKDRLNALGFSLEQRLDNSEKLFGYQSLSPE
ITAGNHSDGGGTLTSSVEGSAPGSMEDLLSQDEHTLMDNQHSNSMDNLDSECSEVYQPLT
SSDDALDAPSSSESEGVPSIERSRKGSSGNASEVSVACLTERIHQMEENQHSTAEELQAT
LQELADLQQITQELNSENERLGEEKVILMESLCQQSDKLEHFSRQIEYFRSLLDEHHISY
VIDEDMKSGRYMELEQRYMDLAENARFEREQLLGVQQHLSNTLKMAEQDNKEAQEMIGAL
KERNHHMERIIESEQKSKTAIASTLEEYKATVASDQIEMNRLKAQLEHEKQKVAELYSIH
NSGDKSDIQDLLESVRLDKEKAETLASSLQEELAHTRNDANRLQDAIAKVEDEYRVFQEE
AKKQIEDLNVTLEKLRAELDEKETERSDMKETIFELEDEVEQHRAVKLHDNLIISDLENT
VKKLQDQKHDMEREIKNLHRRLREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDLKRR
LHEAQEKNEKLTKELEEIKSRKQEEERGRVYNYMNAVERDLAALRQGMGLSRRSSTSSEP
TPTVKTLIKSFDSASQVPSPAAATIPRTPLSPSPMKTPPAAAVSPMQRHSISGPISASKP
LATLTDKRPSYAEIPVQAEHLLRTSSTSRPASLPRVPAMESAKSISVSRRSSEEIKRDIS
APDGASPASLMAMGTTSPQLSLSSSPTASVTPTTRSRIREERKDPLSALAREYGGSKRNA
LLKWCQKKTEGYQNIDITNFSSSWNDGLAFCAVLHTYLPAHIPYQELNSQDKDLMQRRNF
TLAFQAAESVGIKSTLDINEMVRTERPDWQNVMLYVTAIYKYFET
Download sequence
Identical sequences G1N7H0
ENSMGAP00000008161 ENSMGAP00000008161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]