SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008667 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008667
Domain Number 1 Region: 34-198
Classification Level Classification E-value
Superfamily EF-hand 1.36e-45
Family Penta-EF-hand proteins 0.000000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008667   Gene: ENSMGAG00000008436   Transcript: ENSMGAT00000009467
Sequence length 199
Comment pep:known_by_projection chromosome:UMD2:6:21186172:21195848:-1 gene:ENSMGAG00000008436 transcript:ENSMGAT00000009467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLYPSHPEKMGFKHAPSTYGAAPGGPAFPGQAQDPLYGYFAAVAGQDGQIDADELQRCLT
QSGIAGAYKPFNLETCRLMISMLDRDLSGTLGFNEFKELWAVINGWKQHFVSFDSDRSGT
VDRQELEKALTNMGFRLSPQAVSAITRRYSTHGKITFDDYIACCVKLRALTECFKRRDAS
QQGFVNFQYDDFIQCVMSI
Download sequence
Identical sequences G1N8L7
ENSMGAP00000008667 ENSMGAP00000008667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]