SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009072 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009072
Domain Number 1 Region: 355-473
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.53e-32
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000009072
Domain Number - Region: 49-90
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0994
Family Mitotic arrest deficient-like 1, Mad1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009072   Gene: ENSMGAG00000008828   Transcript: ENSMGAT00000009886
Sequence length 476
Comment pep:known_by_projection chromosome:UMD2:21:10321031:10345318:-1 gene:ENSMGAG00000008828 transcript:ENSMGAT00000009886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TNTMASEIDNLSSREAKTVCEALGRYEDTLRGAVREIHVDIQVFKQGVSRQVDEVLRIAS
PLARSVSELQQENQRLRVQLERLARQVEALSRSAGLPQEWRDEAERSPPAVGSSSPVPAF
SADRFSNLAKLAVSGRSQSVDLDDHHKPEFRRVFSSSIIENGHQSSSGTRIVHQFLQSAV
NGIMSQNSSPEAHAPAMTLQMPHLPVTAVTRISEKFSGETIHSAGTTSASTGLLGQNQSK
NEMALKTSNQSLLEKYLEKLSSSFKFYLTQAKNVGKPSFVAPPSSPHFTNDTYCGATPKP
HSSPPTIHRQVERRRELVRSQTLPRTTGTQARKALFEKFEQDSGKGKGQSRPKLKRSQSF
GVASASSIKQILLDWCRSKTIGYKHIDLQNFSSSWNDGMAFCALVHSFFPETFDYNKLDP
ANRKQNFELAFTMAEKMAHCDRLIEVDDMMMMGHKPDPMCVFTYVQSLYNHLRRFE
Download sequence
Identical sequences G1N9I1
ENSMGAP00000009072 ENSMGAP00000009072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]