SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009395 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009395
Domain Number 1 Region: 1-175
Classification Level Classification E-value
Superfamily L domain-like 2.18e-35
Family Ngr ectodomain-like 0.044
Further Details:      
 
Domain Number 2 Region: 184-361
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.69e-20
Family G proteins 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009395   Gene: ENSMGAG00000009124   Transcript: ENSMGAT00000010217
Sequence length 522
Comment pep:novel chromosome:UMD2:5:15964319:15968261:-1 gene:ENSMGAG00000009124 transcript:ENSMGAT00000010217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LREVTLSTQRLRVLPPAVLSNPALESLDLDRNKLRSITGISKLGNLKKLIVSKNEIVDFP
NEIQSLIYLEKLELNQNQIRVIPEGIFCHLPRLKHLRLNNNRLGALPRDLAACRGSLQYL
NISNNLFRTFPHAVLQLANLQELHVQNNALRQLPRELFQGQSLKMFKANGNPLREPPSEV
CAGGIQQILNYFNQLQDGSGQEDKRIKTMFLGASLAGKSTICRSLKQRQAKLVPKEERTV
GIEISEFRIEDFTFLFWDFAGQLEYYMTHHVFITPQALVILVINLHMYQTNDDAFKDLVG
FWINNLFMRVPNSVVLPVGTHVDCCQKQEVEEKRSNIMAKIAAMLAERKSNLTHFINNLE
DSEEPEVYLKGELGKLAGFGLAHMGRFSSLVHHSFNVLSLFQILDLVAVNCTDHRDIKKL
EATILEHVKNEELFPEVVRVLPPVYREVEAAIVDITQSMMDLQYLLSELSQRDHLANLDR
ELLQDILRYLHRIGLLVWYEEIKHLESTVFLQPTFLITTFKV
Download sequence
Identical sequences G1NA77
ENSMGAP00000009395 ENSMGAP00000009395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]