SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009564 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009564
Domain Number 1 Region: 13-315
Classification Level Classification E-value
Superfamily L domain-like 3.4e-39
Family Polygalacturonase inhibiting protein PGIP 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009564   Gene: ENSMGAG00000009272   Transcript: ENSMGAT00000010391
Sequence length 367
Comment pep:known_by_projection chromosome:UMD2:12:16926884:16971486:1 gene:ENSMGAG00000009272 transcript:ENSMGAT00000010391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASELCKTISEAKLEKHKNLFLNYRNLHHFPLELLKDEGLQYLERLYMKRNSLTTLPENL
AQKLPNLVELYLHSNNIVVVPEAIGSLVKLQFLDLSDNALEIVCPEIGRLRSLRHLRLAN
NQLKYLPAEVGDLRELQTLDISTNRLITLPERLHMCLSLQYLTADRNHLWYVPRHLCQLP
SLNELSMAGNRLAFLPLDLGRSRELQYVYVDNNIHLKGLPSFLYNKVIGCSGCGSPIQVS
EVKLLSFSSGQLTVFLPAEVKSIGTETDHVLPLQELAMRTLYNTYYVYLKDLNFLTPISL
PKSLLELLHCPLGHCHRCSQPMFTIVYPKLFPLRETPMAGLHQGRTTVSFVAYCCSTQCL
QTFDLLS
Download sequence
Identical sequences E1C7Q6 G1NAK7
ENSMGAP00000018128 9031.ENSGALP00000011418 ENSMGAP00000009564 ENSGALP00000011418 XP_010715837.1.16129 XP_010715839.1.16129 XP_015147571.1.86415 XP_021263074.1.32913 XP_021263075.1.32913 ENSGALP00000011418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]