SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009593 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009593
Domain Number 1 Region: 286-405
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.8e-37
Family Calponin-homology domain, CH-domain 0.0000988
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009593   Gene: ENSMGAG00000009293   Transcript: ENSMGAT00000010422
Sequence length 416
Comment pep:novel chromosome:UMD2:17:10555284:10564365:1 gene:ENSMGAG00000009293 transcript:ENSMGAT00000010422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPAASFSELTLGLRSTPIRITAIPSSTSGICSITTSSNVVKPVEPELVVEQPQAPRLQPE
LPNGMEKVQVREVEKKSKLNVEELNRIEDESVLDKMLDQTTDFEERRLIRNAMRELRQRK
RDQREKERDQRLQEMKSQATMSRAGHNTETTSTQSTQSADGSARSTVTKTERLIQSNDGS
KTSRTTTMESSYVKRSDNGSSSTFVQPNHPTVHLPRSSCSIFDREDESASRQSSLAALER
RQAEKKKELMKAQSLPKTSTSQARKAMIEKLQKEGGSSPNPAAPRAAVQRSSSCGVPNAN
SIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHNFFPDAFDYSQLTPQNRRHN
FEVAFSSAEKHADCPQLLDVEDMVRMREPDWKCVYTYIQEFYRCLVQKGLVKTKKS
Download sequence
Identical sequences G1NAM8
ENSMGAP00000009593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]