SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009661 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009661
Domain Number 1 Region: 131-331
Classification Level Classification E-value
Superfamily L domain-like 3.68e-31
Family Ngr ectodomain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009661   Gene: ENSMGAG00000009351   Transcript: ENSMGAT00000010493
Sequence length 338
Comment pep:known_by_projection chromosome:UMD2:2:19350032:19353011:-1 gene:ENSMGAG00000009351 transcript:ENSMGAT00000010493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGHRMKTLAWVGIASLCLGATWAVPAKKERKKVEKPKPDLVLNENLDLDNYDMTLDSY
GDIMDLNNYEELYDYGDLAPKVEVGTLAPRPKDHGALPELGTAAPTPKLKPLATTNPTHP
APLGLNTAQGLPSCLRCLCIRTSVYCDDTDLEHIPPLPPDTTYLYARFNRIGAIRAGDFM
GLKKLKRIDLTSNSISWADVDAFRLLPSLQELILPENRLTALPELPRSIVRLDARLNRIP
SAGLRPEAFQDLTQLQFLHLSDNQLDYIPAPLPESLRSLHLQNNNIQTMHEDTFCNSQDQ
SHIRRALEDIRLDGNPINLSLFPNAYFCLPRLPTGRFF
Download sequence
Identical sequences G1NAT0
ENSMGAP00000009661 XP_003203890.1.16129 ENSMGAP00000009661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]