SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009680 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009680
Domain Number 1 Region: 83-361
Classification Level Classification E-value
Superfamily L domain-like 8.73e-47
Family Ngr ectodomain-like 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009680   Gene: ENSMGAG00000009375   Transcript: ENSMGAT00000010512
Sequence length 380
Comment pep:known_by_projection chromosome:UMD2:2:19441232:19630710:1 gene:ENSMGAG00000009375 transcript:ENSMGAT00000010512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHWVTILLIAGLCGASLGQYNEEEDLAWLQYYMRQSRMSSYNYMPYYEDENSPYVYSYLP
APDTEAEPIPEAQQASSWQCPQECDCPPNFSSAMYCDTRNLRYLPFVPTRMKYVYFQNNQ
ITAIQEAAFDNATELEWLALHNNQISSEKMGKRVFAKLKNLERLYMNNNNLTKMPSPLPR
SLRELHLSYNQISKVPSNALEGLENLTALYLSHNYIFEMGASLKGLKSLILADLSYNHLR
KVPDGLPMALEQLYLEYNYINTIPDDYFKVSPKLLYVRMSHNSLTNQGLSTNTFNSSSIL
ELDLSYNRLQKIPRVSTNLENLYLQGNQINEFSISSFCTVVDVMNYSRLQVLRLDGNEIK
RNAMPPDAPLCLRRATVIEI
Download sequence
Identical sequences G1NAU5
ENSMGAP00000009680 ENSMGAP00000009680 XP_010722717.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]