SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009800 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009800
Domain Number 1 Region: 1-205
Classification Level Classification E-value
Superfamily CutC-like 2.35e-61
Family CutC-like 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009800   Gene: ENSMGAG00000009482   Transcript: ENSMGAT00000010635
Sequence length 208
Comment pep:known_by_projection chromosome:UMD2:8:24345613:24348618:-1 gene:ENSMGAG00000009482 transcript:ENSMGAT00000010635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLLQVVKQCVRVPVFVMIRPRGGDFLYSDREVEVMKADIRLAKLHGADGLVFGALTEDGR
IDTELCTALLAVCRPLPVTFHRAFDMVHDPQVALETLISLGFERVLTSGCDSSALEGLSL
IKKLAEQAKGRIVVVPGGGITERNLQRILEGSSASEFHCSARSARDSGMKFRNPNVAMGA
SFSAPEYSIKVADVAKVRTLNAIAKNIL
Download sequence
Identical sequences G1NB40
ENSMGAP00000009800 ENSMGAP00000009800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]