SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009934 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009934
Domain Number 1 Region: 36-139
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-30
Family Calponin-homology domain, CH-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009934   Gene: ENSMGAG00000009623   Transcript: ENSMGAT00000010776
Sequence length 152
Comment pep:known_by_projection chromosome:UMD2:5:17008261:17009153:1 gene:ENSMGAG00000009623 transcript:ENSMGAT00000010776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPRVSSRACGRSAILEKFGGAATGPAPHLKRAGATGSVKAMLLEWCRARTRGYQHVDIQN
FSGSWSSGLAFCALIHSFFPDAFDYGSLEPQDRQRNFTLAFTTAEERVDCAQLLEVEDML
RLAVPDAKCIYTYVQELYRSLVAKGLVKTKKR
Download sequence
Identical sequences G1NBD9
ENSMGAP00000009934 ENSMGAP00000009934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]