SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010859 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010859
Domain Number 1 Region: 343-549
Classification Level Classification E-value
Superfamily L domain-like 2.04e-34
Family Ngr ectodomain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 39-272
Classification Level Classification E-value
Superfamily L domain-like 1.63e-33
Family Ngr ectodomain-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010859   Gene: ENSMGAG00000010464   Transcript: ENSMGAT00000011724
Sequence length 551
Comment pep:known_by_projection chromosome:UMD2:11:21268067:21269804:1 gene:ENSMGAG00000010464 transcript:ENSMGAT00000011724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HKGRMWWIILLSTIALAWTTPIPLIEDSEELDEPCFDPCYCEVKESLFHIHCDNKGFINI
SQITESWSRPFKLYLQRNSMRKLYTNSFLHLNNAVSINLGNNALQDIQTGAFNGLRVLKR
LYLHENKLDIFRNDTFLGLESLEYLQADYNVIKRIESGAFRNLSKLRVLILNDNLIPMLP
TNLFKSVSLTHLDLRGNRLKVLSYRGMLDHIGRSLMEIQLEENPWNCTCEIVQLKSWLER
IPYTALVGDITCETPFHFHGKDLREIKRSKLCPMLSDSESSMLSSFHFTASSVEYKTSNK
QPKPTKQPRVPRPPPTPRGLYPGPNQPPVAAYQTRPPIPIICPTGCSCSLHINDLGLTVN
CKERGFHNISELLPRPLNAKKLYLSGNLIQKIYRSDFWNFSSLDLLHLGNNRISYVQDGA
FINLPNLKSLYLNGNDIERLTPGMFRGLQSLHYLYFEYNLIREIQPAAFSLMPNLKLLFL
NDNLLRTLPTDAFAGTSLARLNLRNNHFLALPVAGVLEHLHAIVQIDLKLNPWDCTCELV
PLKQWLEALSS
Download sequence
Identical sequences G1NDD9
ENSMGAP00000010859 ENSMGAP00000010859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]