SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011116 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011116
Domain Number 1 Region: 6-135
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.99e-50
Family Calponin-homology domain, CH-domain 0.000000537
Further Details:      
 
Domain Number 2 Region: 206-265
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 6.28e-19
Family EB1 dimerisation domain-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011116   Gene: ENSMGAG00000010690   Transcript: ENSMGAT00000011985
Sequence length 288
Comment pep:known_by_projection chromosome:UMD2:3:57384050:57428575:1 gene:ENSMGAG00000010690 transcript:ENSMGAT00000011985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCSWGMAVNVYSTSITQETMSRHDIIAWVNDILALNYTKVEQLCSGAAYCQFMDMLFPGC
ISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFF
DANYDGKEYDPVEARQGQDALPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPASKPGSTP
SRPSSAKKAAPSSSASKSDKDLETQVIQLSEQVHSLKLALEGVEKERDFYFGKLREIELL
CQEHGGENNDLVHRLMEVLYASEEHESHTEEHEGEEQVHEQPQQQEEY
Download sequence
Identical sequences G1NE00
ENSMGAP00000011116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]