SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011750 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011750
Domain Number 1 Region: 210-514
Classification Level Classification E-value
Superfamily RNI-like 6.67e-54
Family 28-residue LRR 0.038
Further Details:      
 
Domain Number 2 Region: 7-300
Classification Level Classification E-value
Superfamily L domain-like 4.65e-43
Family Ngr ectodomain-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011750   Gene: ENSMGAG00000011248   Transcript: ENSMGAT00000012631
Sequence length 535
Comment pep:known_by_projection chromosome:UMD2:10:25324429:25343808:1 gene:ENSMGAG00000011248 transcript:ENSMGAT00000012631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CTQEGVVDCGGIDLKEFPLLLPELTNHLSLQNNQIEEIFPEELARLHRLETLNLQNNRLT
SKGLPEEAFEHLENLNYLYLANNKLTVAPKFLPNTLISADFAANYLTKIYGLTFGQKPNL
RSVYLHNNKLSDAGLPDNMFNGSNNVEILIMSSNFLKYVPKNLPPALYKLHLKNNKLEKI
PKGAFSELTGLRELYLQNNYLTNEGMDNETFWKLSSLEYLDLSSNNLSQIPSGLPRNIVL
LHLEKNAIKVIGRDVLTQIKNLEYLLLHNNKLKARGIHPSAFQGLKKLHTVHLYNNLLER
IPSGLPRRVKTLMILHNQISEINRNDFATTYFLEELNLSYNKLKSPQIHREAFRKLRQLK
SLDLSGNNLNTVPYGFPKNLQVLKLKENEISDIPKGTLSGMTKLRELYLSNNKLKVNSIY
SRAWRELSSLQSLDMAGNQLTSIPSGLPESLEYLYLQNNKITVVSENVFESTPKLKGIYL
RFNKIAVGALKVNTFQSLQHLQVLDIEGNLEFSNTSKNKDDSEEELEDEEDEEKR
Download sequence
Identical sequences G1NFG4
ENSMGAP00000011750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]