SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011777 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011777
Domain Number 1 Region: 26-227
Classification Level Classification E-value
Superfamily L domain-like 3.4e-31
Family Internalin LRR domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011777   Gene: ENSMGAG00000011271   Transcript: ENSMGAT00000012658
Sequence length 279
Comment pep:known_by_projection chromosome:UMD2:3:65530149:65542564:-1 gene:ENSMGAG00000011271 transcript:ENSMGAT00000012658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRLTTDLVARCLGHRNRREEDLGRHLRKITHLNLSDKNLDAIGDISLCRNLRVLYLYDN
QISQIQNLGFASHLTHLYLQNNRISCIENLSSLKNLEKLYLGGNSIAVVEGLDQLKEIRE
LHIESQHLPLGEKLLFDPRSLRSLAKSLSVLNISNNNIDELEQLAVLENLSHLRAADNQL
QHMKDLEVVLHKWTKLCSMDLTGNPICHKPKYRDRIVVQSPTLEYLDGKEIKEMERVFLM
NWKASKAVRKKSKEKALKENTLSSSISAAGFETPHSILP
Download sequence
Identical sequences G1NFI7
ENSMGAP00000011777 ENSMGAP00000011777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]