SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011863 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011863
Domain Number 1 Region: 3-237
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.96e-80
Family Calponin-homology domain, CH-domain 0.0000131
Further Details:      
 
Domain Number 2 Region: 1181-1333
Classification Level Classification E-value
Superfamily Spectrin repeat 5.07e-35
Family Spectrin repeat 0.00028
Further Details:      
 
Domain Number 3 Region: 1404-1545
Classification Level Classification E-value
Superfamily Spectrin repeat 3.96e-31
Family Spectrin repeat 0.00065
Further Details:      
 
Domain Number 4 Region: 256-378
Classification Level Classification E-value
Superfamily Spectrin repeat 8.77e-31
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 5 Region: 1497-1645
Classification Level Classification E-value
Superfamily Spectrin repeat 6.28e-29
Family Spectrin repeat 0.00056
Further Details:      
 
Domain Number 6 Region: 654-806
Classification Level Classification E-value
Superfamily Spectrin repeat 4.8e-27
Family Spectrin repeat 0.00086
Further Details:      
 
Domain Number 7 Region: 763-908
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-21
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 8 Region: 1657-1761
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-21
Family Spectrin repeat 0.0007
Further Details:      
 
Domain Number 9 Region: 1819-1974
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-20
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 10 Region: 544-666
Classification Level Classification E-value
Superfamily Spectrin repeat 1.04e-19
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 11 Region: 967-1092
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-18
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 12 Region: 375-487
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000516
Family Spectrin repeat 0.0008
Further Details:      
 
Domain Number 13 Region: 1980-2031
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000115
Family Spectrin repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011863   Gene: ENSMGAG00000011342   Transcript: ENSMGAT00000012745
Sequence length 2032
Comment pep:known_by_projection chromosome:UMD2:5:26007012:26058411:-1 gene:ENSMGAG00000011342 transcript:ENSMGAT00000012745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKRLQEQRMFMQKKTFTNWMNNIFFRNNVRAEIENIYTDLKDGIYLMQLLELLSGESLPR
PNRGKMRVHFLENNSKAITFLKSKQVQVKVIGPENIVDGDRTLILGLIWIIILRFQISSI
KLDKEEFGGKADQLFANEALLLWCQHKTASYPNVNVKDFSKSWSDGLAFNALIHAHRPDL
INYSSLRQDQPIKNLNNAFNVAEKELGISKLLDAEDVAVPSPDERSIMTYVSLYYHYFSR
MKQGQTNQKRLAKIVFLLKEIDDLKLLYEQMVSDLLKWIKQKVIELDDRIFPNSLQEMWL
LMANFKTFRTVEKPPKYQDKGMIEAHLFNIRTKQRANNLRLYVPPEGRTLQDVEKHWIIL
EKAEHNRGKALQKEMLRLEKLEQLAKRFLKKAALREAYLEDMRKVIGKQDFWPESIDRME
AASKKLEAIVADVLPRRERFAALAEMATVISQNNYHSKDQIVKKENSISKQWQDLLDQLQ
KRQHSLSTMQEILALLRDIDAIMEELKELQALVNSQDCGKQLLEVVDLLQKHNLIDLQIS
SYDDRLTHITQRTAEISKDSTVKAEVLYAKVPMLRQLYQNLIAQSRTRKSQLEEALKLFE
FFRDCKEEESWISEKWKIARTTTLGKDVSQITASIQKHKALEAECNSHRAICADVMRRGW
DLSQKNPTHEEDIQKQRDKLQTLWQRLQDEVANRKNRLQAAALIKQYFADIDEANSWLQE
RQPLLASKDYGKDESSAEALLHRHLRLEKEIAAYSTEMRRLKEQAVIAAEQAPAAVKNIW
KTQDEIDSLYENLQSMAEDRKKALEEMIGYYRFCSSCEAFQSWMREKEKIFRTLQPQADN
VEVMQQKYQSFLTELAAGKGQLGEIESLAAKFGKNSPGKYTEIQIWLEEINARWEHMESL
KEEKGSELIGVADVRTFLEDCQSIEVLLQDKIGQLRDLEPGNLPAGLESDKRKLSAVERE
VLVMERKIEYLRSVAKSIKDTNPAESKAITEQVEYMERLLVNLKLETQRKHDLLQQAQNQ
QSFLQDSRRLLLWAEGIREKLRSEEMGVDVASAEQLLREHQDLLKEIRSQKERFVQLEEL
GRKVIQKQPSSSRTRDVHLSVERLAQENKELENMWEQRWKKLQDGLELQKFNREGDRINA
ALSSHEAFLRGDDLGDHVDAVRSLQKQHQEFEQLLMVLKRRIETFNENGADLIESGHFAS
HIIKERMATLRQRWERLIESNSKRKQRLLDSLQLQEFNRDAAELLIWMEEKYKIASDESY
RDPTNVLRKLKWHEAAEKEMMANEKHFATLIKKGNQLIQDNHYAAASIQKKMSELEKKWK
ELYGKMIERGDKLRQAGQQEQLMELLQDAKKKIEKIEKVLQEAETGHDLRSSRDLLKQHR
QLENETHELAEKMNSIVSHAMKMAANHFDSQRILDETQKYLKRFESLQAPLGERRKLLEA
AVDLYEFYHYHDMELNWINERLPIANSTNCGKSLDVAQSLLQKHKEFQAEVNAHKQQVQR
VLDKGRTMIESQHPSAQKISEKCQELVTAWQGLEKACEERMKQLQHSVGFQEFLMNTSDL
EAWIAEKRPLVMSKDYGKDEDGTLKLLKKHKVLEHEIAVYQDLIKELNESVQNLPAVGSI
QYVEVDAPREQVHSRLRELQELAAKSRGKKLDETLGLHEFLREYEDLQDWMAQQKQAASS
EDYGNDYEHVLKQLCAKYDTFRHQLEATGRRVMTCQQLAENLLNSGHSESREIRQKQKEL
RNSWEELLEITRLRGERLKDAEVIHKCYQDLTDALAHIEEKSKSIPDDVAKDMRGVQTQL
RNHVALEHELLGNEQQVTKLQDLIRSADHVLTRCTNKQASDLKAKQQAIATNWKALKSKV
QLRKELLEQAHKLYQFQAQVWDYFSWTSEMIREMRAKETIRDISTSSLRLTQHQQLLAEI
EAQEEKYNQVVQLGQSLLQDEEIRSKEIQQKLQALLEEKDKVYSEWKKKKKWLDKIHQEQ
MFYRDWNHLDKLLNSQEVYLKSSDLGSSVDEVEQLIRKHEAFEKLLASQDEK
Download sequence
Identical sequences G1NFR0
ENSMGAP00000011863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]