SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011883 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011883
Domain Number 1 Region: 6-247
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.73e-78
Family Calponin-homology domain, CH-domain 0.0000131
Further Details:      
 
Domain Number 2 Region: 1236-1388
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-34
Family Spectrin repeat 0.00028
Further Details:      
 
Domain Number 3 Region: 2513-2669
Classification Level Classification E-value
Superfamily Spectrin repeat 4.76e-34
Family Spectrin repeat 0.00051
Further Details:      
 
Domain Number 4 Region: 2830-2984
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-31
Family Spectrin repeat 0.00027
Further Details:      
 
Domain Number 5 Region: 2725-2879
Classification Level Classification E-value
Superfamily Spectrin repeat 3.98e-31
Family Spectrin repeat 0.00088
Further Details:      
 
Domain Number 6 Region: 1459-1600
Classification Level Classification E-value
Superfamily Spectrin repeat 7.92e-31
Family Spectrin repeat 0.00065
Further Details:      
 
Domain Number 7 Region: 266-388
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-30
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 8 Region: 3042-3197
Classification Level Classification E-value
Superfamily Spectrin repeat 2.95e-29
Family Spectrin repeat 0.00099
Further Details:      
 
Domain Number 9 Region: 1552-1699
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-28
Family Spectrin repeat 0.00056
Further Details:      
 
Domain Number 10 Region: 1131-1283
Classification Level Classification E-value
Superfamily Spectrin repeat 6.54e-24
Family Spectrin repeat 0.00088
Further Details:      
 
Domain Number 11 Region: 3533-3634
Classification Level Classification E-value
Superfamily PH domain-like 1.67e-23
Family Pleckstrin-homology domain (PH domain) 0.0014
Further Details:      
 
Domain Number 12 Region: 3257-3410
Classification Level Classification E-value
Superfamily Spectrin repeat 3.08e-23
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 13 Region: 608-711
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-22
Family Spectrin repeat 0.00051
Further Details:      
 
Domain Number 14 Region: 836-968
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-20
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 15 Region: 1712-1821
Classification Level Classification E-value
Superfamily Spectrin repeat 5.52e-20
Family Spectrin repeat 0.00077
Further Details:      
 
Domain Number 16 Region: 2196-2330
Classification Level Classification E-value
Superfamily Spectrin repeat 3.29e-19
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 17 Region: 1890-2031
Classification Level Classification E-value
Superfamily Spectrin repeat 8.47e-19
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 18 Region: 2347-2464
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-17
Family Spectrin repeat 0.0009
Further Details:      
 
Domain Number 19 Region: 716-777,824-866
Classification Level Classification E-value
Superfamily Spectrin repeat 3.39e-16
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 20 Region: 1027-1144
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000238
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 21 Region: 385-497
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000114
Family Spectrin repeat 0.0008
Further Details:      
 
Domain Number 22 Region: 505-607
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000023
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 23 Region: 2003-2092
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000262
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 24 Region: 3415-3480
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000331
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 25 Region: 1825-1925
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000134
Family Spectrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011883   Gene: ENSMGAG00000011342   Transcript: ENSMGAT00000012765
Sequence length 3634
Comment pep:known_by_projection chromosome:UMD2:5:25971936:26058444:-1 gene:ENSMGAG00000011342 transcript:ENSMGAT00000012765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITMNSEFEKDHIKRLQEQRMFMQKKTFTNWMNNIFFRNNVRAEIENIYTDLKDGIYLMQL
LELLSGESLPRPNRGKMRVHFLENNSKAITFLKSKVQVKVIGPENIVDGDRTLILGLIWI
IILRFQISSIKLDKEEFGGKADQLFANEALLLWCQHKTASYPNVNVKDFSKSWSDGLAFN
ALIHAHRPDLINYSSLRQDQPIKNLNNAFNVAEKELGISKLLDAEDVAVPSPDERSIMTY
VSLYYHYFSRMKQGQTNQKRLAKIVFLLKEIDDLKLLYEQMVSDLLKWIKQKVIELDDRI
FPNSLQEMWLLMANFKTFRTVEKPPKYQDKGMIEAHLFNIRTKQRANNLRLYVPPEGRTL
QDVEKHWIILEKAEHNRGKALQKEMLRLEKLEQLAKRFLKKAALREAYLEDMRKVIGKQD
FWPESIDRMEAASKKLEAIVADVLPRRERFAALAEMATVISQNNYHSKDQIVKKENSISK
QWQDLLDQLQKRQHSLSTMQEILALLRDIDAIMEELKELQALVNSQDCGKQLLEVVDLLQ
KHNLIDLQISSYDDRLTHITQRTAEISKDSTVKAEVLYAKVPMLRQLYQNLIAQSRTRKS
QLEEALKLFEFFRDCKEEESWISEKWKIARTTTLGKDVSQITASIQKHKALEAECNSHRA
ICADVMRRGWDLSQKNPTHEEDIQKQRDKLQTLWQRLQDEVANRKNRLQAAALIKQYFAD
IDEANSWLQERQPLLASKDYGKDESSAEALLHRHLRLEKEIAAYSTEMRRLKEQAVIAAE
QAPAAVMNQNFAQQMVKTEAPGDLNQKTTKLPFSRTWATSESALPGSSGLDVHFVPENIW
KTQDEIDSLYENLQSMAEDRKKALEEMIGYYRFCSSCEAFQSWMREKEKIFRTLQPQADN
VEVMQQKYQSFLTELAAGKGQLGEIESLAAKFGKNSPGKYTEIQIWLEEINARWEHMESL
KEEKGSELIGVADVRTFLEDCQSIEVLLQDKIGQLRDLEPGNLPAGLESDKRKLSAVERE
VLVMERKIEYLRSVAKSIKDTNPAESKAITEQVEYMERLLVNLKLETQRKHDLLQQAQNQ
QSFLQDSRRLLLWAEGIREKLRSEEMGVDVASAEQLLREHQDLLKEIRSQKLEELGRKVI
QKQPSSSRTRDVHLSVERLAQENKELENMWEQRWKKLQDGLELQKFNREGDRINAALSSH
EAFLRGDDLGDHVDAVRSLQKQHQEFEQLLMVLKRRIETFNENGADLIESGHFASHIIKE
RMATLRQRWERLIESNSKRKQRLLDSLQLQEFNRDAAELLIWMEEKYKIASDESYRDPTN
VLRKLKWHEAAEKEMMANEKHFATLIKKGNQLIQDNHYAAASIQKKMSELEKKWKELYGK
MIERGDKLRQAGQQEQLMELLQDAKKKIEKIEKVLQEAETGHDLRSSRDLLKQHRQLENE
THELAEKMNSIVSHAMKMAANHFDSQRILDETQKYLKRFESLQAPLGERRKLLEAAVDLY
EFYHYHDMELNWINERLPIANSTNCGKSLDVAQSLLQKHKEFQAEVNAHKQQVQRVLDKG
RTMIESQHPSAQKISEKCQELVTAWQGLEKACEERMKQLQHSVGFQEFLMNTSDLEAWIA
EKRPLVMSKDYGKDEDGTLKLLKKHKVLEHEIAVYQDLIKELNESVQNLPAVGSIQYVEV
DAPREQVHSRLRELQELAAKSRGKKLDETLGLHEFLREYEDLQDWMAQQKQAASSEDYGN
DYEHVLLFSLQKQLCAKYDTFRHQLEATGRRVMTCQQLAENLLNSGHSESREIRQKQKEL
RNSWEELLEITRLRGERLKDAEVIHKCYQDLTDALAHIEEKSKSIPDDVAKDMRGVQTQL
RNHVALEHELLGNEQQLQDLIRSADHVLTRCTNKQASDLKAKQQAIATNWKALKSKVQLR
KELLEQAHKLYQFQAQVWDYFSWTSEMIREMRAKETIRDISTSSLRLTQHQQLLAEIEAQ
EEKYNQVVQLGQSLLQDEEIRSKEIQQKLQALLEEKDKVYSEWKKKKKWLDKIHQEQMFY
RDWNHLDKLLNSQEVYLKSSDLGSSVDEVEQLIRKHEAFEKLLASQDEKVQSPIEIRLFS
CTCSEYSTRLTVLVFSKVRIKEMVSGECAAKMRNTLLVFMVQLVVQAEDWISERMQKLED
PSIQDQMKKSSQLLIRHKSITAEEKTCNIVMTLEAKKGEALVSMGHPKSGEIRRQVRMLQ
ERWEKLKRAVAARGKMLEDSRDFLEFLQKVDQVEAWIREKEVMINVGDVGNDYEHCLQLM
KKLNEFRGATSGETTVDDAHIKAINALAMKLERQNKEETKTIYQRRKQLNENKRWNSFHG
NLNAYRRKLEGALEIHALIREIDDITERITEKSVLIQALDYGKDVGSVENLIRRHEEMER
EINVIKSKIEPLELESFRLSTRNPSINDKLTMKQQEMKNNWLRLQGQAKQRKEKLAASYQ
LQKFNFEMKEIIDWIQNIRGLMEAGGLPKSLNEAESMIEEHQQRKEEIEARVERFNSLSN
YGQQLANSGHYATPEIHQSLSRLQKAWSELIQAWQEQYIKLFQAQDLQKFYGYVEQTESW
LSSKEAFLANEDLGDSVSSVESLQRKHMQFEKSLEAQMEKIDEMASFAQQLIQNKHYDSD
NITNRCQAVLRRKEKLLENAAARRHLLEESRLLQKLLKNSYEVAAWINEKNSIAQDDSWR
DPSNLQTKLQKHQTFQAEIMANRNRLDSIKLEGEKMLRERHYAPEAIQSRLQEMEELWEE
LLASCQDKRAKLQDAYKALHFQRSIEDTEKWLEDVENELKAPYSSNDLVVLNSHLKKQEE
LEQDIASHRDRLQELVNTAQEFQQEKHFLADELEERVDQLVQRYKSLRDPLQERRGSLEA
SRLQYQFFRDVDEELAWVHEKLPMASSRDYGQSLATVQSLQEKHQNLENEISSRDALTKA
VLSTGQKLVRGGHSASRKIMEQMKELETSVENLKTEAQVRRQRLMQSYEAHQFLTELLDV
ETWLAERSFILETSDYGKNEESTQALLRKLEATKLDMEGFRPRIEKVQETGAGLINKDNP
ESPTILSKLQGILADYQSLLQKAETQRKCLQEQFQLYQFEREFQLVDTWLSSKQSIAESD
DYGQDLDGVEVLEKKFKDFVNEIKPLGHSKVLSLNELASKLEKDGHSKTDIIQKRTKQIN
EMWEKLCHAIQTRTENLRAAQQVHQYDHDVDEVKGWMQEKEAVVDIDDYGYDLPGVQTLL
SQLEGVERDLGAIMKELERIRGEAWHLSRTYPQLKENIMERLTDVDECWRNLDKKFLERK
ARLSQAEQVQLYFNDCRELMAWANEMHALVISEELANDVLGAELLIKRHEEYKREIEKQW
LKYEEIQRAGDDLMRNGHFMSVEIEEKLLELSELMKKVKESWNMRKELYEENWEIQLLRR
ELEQAEAWLAAKESFLSDPNYGDSVSEVEELLKKHRDFENMLAVQEEKFAQLSRKTKREM
NLLKQTDAELLAQAGNSLLTHRWGHMDSLHHLQGLLKSLTAVFLSQVSASLQHMEGFLEK
RDQLLPGRQQPGSRSWKSFYVKLDGLKLDFYNDEQEASKNISTLPSLSIVGAKCERLTNY
IRKENTFMLRLRDGAEYFFSAPSPKLMENWLQSL
Download sequence
Identical sequences G1NFS5
ENSMGAP00000011883 ENSMGAP00000011883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]