SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012086 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012086
Domain Number 1 Region: 18-212
Classification Level Classification E-value
Superfamily L domain-like 4.93e-39
Family Internalin LRR domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012086   Gene: ENSMGAG00000011547   Transcript: ENSMGAT00000012973
Sequence length 238
Comment pep:known_by_projection chromosome:UMD2:5:26510525:26514721:-1 gene:ENSMGAG00000011547 transcript:ENSMGAT00000012973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSALKAHLETAQKTGVFQLTGKGLTEFPEDLQKLTSNLRTIDLSNNKIELLPPLIGKF
SLLKSLVLNNNKLTALPEELCRLKKLETLHLNGNHLRQLPAAFGQLSALKTLSLSGNQLR
TVPTQLCGLRHLDVVDLSKNQIQNVPDSVGELQAIELNLNQNQISQISVQISHCPRLKVL
RLEENCLELSMLPQSILSDSQISLLAVEGNLFEIKKLRELEGYDKYMERFTATKKKFA
Download sequence
Identical sequences G1NG92
ENSMGAP00000012086 XP_003206525.1.16129 ENSMGAP00000012086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]