SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012192 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012192
Domain Number 1 Region: 44-194
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.56e-30
Family Calponin-homology domain, CH-domain 0.0024
Further Details:      
 
Domain Number 2 Region: 216-293
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.07e-27
Family GAS2 domain 0.0000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012192   Gene: ENSMGAG00000011632   Transcript: ENSMGAT00000013079
Sequence length 677
Comment pep:known_by_projection chromosome:UMD2:1:48162496:48175518:1 gene:ENSMGAG00000011632 transcript:ENSMGAT00000013079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTMQNAVQVWFGDDLPLSPRSPLTPRHGPGLADVCLYDQWISVRHEATLVPMQEDLSIWL
SGLLGIEVTAEQLLEELDNGVLLCQLIGVLQNTIKKSCSSNNLRNFPMRKVPCKKDAPSG
SFFARDNTANFLNWCRAIGVDETYLFESEGLVLHKDPRQVYLCLLEIGRIVSRYGVEPPV
LVKLEKEIELEETLLRTSGPASPVDTAKSCCHHGDLHEAVKHIAEDPPCSCSHRFSIEYL
SEGRYRLGDKILFIRMLHGKHVMVRVGGGWDTLQGFLLKYDPCRVLQFATLEQKILAFQK
GVTSDNISIMNPMSAVNMFQKQPANPPTPVPALKARPKLADTQSPFKPLMGTSKKLASPA
HHSPAPVPSLPASKSSSSTRSRAALVHSETLRERIRSPDAPKVRFAPAQGSPATGMHSAL
SASKRQLSQLPATGEALASKQKCVPSKSKPVSVTKTKVNSVAPRPARPPASNLRAVAKFA
HSQQLYVKSPSENTTQGSGTGSQHPQKAPQTASHLARNLKTASILKHSASVPSLAVSKSL
KSPPMPGSASKNLIASVNKTPTTEHLQTQNVNKPPEVGPSSSKPPERTPLSVVRLPQTSA
KVAVTKKAVQPSTKSQPSSRDLQANGNLVPAAKKPLSKGKSATACNKGAPTAPKGSLLKS
KQDDHYFVMTGSKKPRK
Download sequence
Identical sequences G1NGH4
ENSMGAP00000012192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]