SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012328 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012328
Domain Number 1 Region: 16-256
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.18e-86
Family Calponin-homology domain, CH-domain 0.0000277
Further Details:      
 
Domain Number 2 Region: 274-396
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-34
Family Spectrin repeat 0.000000247
Further Details:      
 
Domain Number 3 Region: 510-631
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-31
Family Spectrin repeat 0.00000084
Further Details:      
 
Domain Number 4 Region: 397-505
Classification Level Classification E-value
Superfamily Spectrin repeat 7.46e-24
Family Spectrin repeat 0.00000107
Further Details:      
 
Domain Number 5 Region: 739-867
Classification Level Classification E-value
Superfamily EF-hand 2.3e-22
Family EF-hand modules in multidomain proteins 0.007
Further Details:      
 
Domain Number 6 Region: 635-746
Classification Level Classification E-value
Superfamily Spectrin repeat 6.05e-22
Family Spectrin repeat 0.00000089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012328   Gene: ENSMGAG00000011723   Transcript: ENSMGAT00000013218
Sequence length 894
Comment pep:known_by_projection chromosome:UMD2:2:38309279:38388240:-1 gene:ENSMGAG00000011723 transcript:ENSMGAT00000013218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNSIHXNMQYTYNYEEDEYMTQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIE
NIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAE
EIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHLSW
KDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKP
DERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRT
IPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRPAF
MPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHEQWAYGK
EQILLQKDYESASLTEVRAMLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAASVN
DRCQKICDQWDSLGTLTQKRREALERTEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQ
DMFIVHSIEEIQSLISAHDQFKATLPEADGERQAILSIQNEVEKVIQSYSMRISASNPYS
TVTVEEIRTKWEKVKQLVPQRDQSLQEELARQHANERLRRQFAAQANVIGPWIQTKMEEI
ARSSIEMTGPLEDQMNQLKQYEQNIINYKHNIDKLEGDHQLIQEALVFDNKHTNYTMEHI
RVGWELLLTTIARTINEVETQILTRDAKGITQEQMNDFRASFNHFDRRKNGLMDHDDFRA
CLISMGYDLGEAEFARIMSLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILAS
DKPYILADELRRELPPEQAQYCIKRMPQYTGPGSVPGALDYTSFSSALYGESDL
Download sequence
Identical sequences G1NGT5
ENSMGAP00000012328 ENSMGAP00000012328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]