SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012808 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012808
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000191
Family Calponin-homology domain, CH-domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012808   Gene: ENSMGAG00000012183   Transcript: ENSMGAT00000013706
Sequence length 1007
Comment pep:known_by_projection chromosome:UMD2:4:51338944:51405598:-1 gene:ENSMGAG00000012183 transcript:ENSMGAT00000013706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DNIILFLRGCKELGLKESQLFDPGDLQDTSNRVTVKNIDCSRKLKNVLVTIYWLGKAANS
CTSYSGSTLNLKEFEGLLAQMRKETEDIESPKRSIRDSGYIDCWDSERSDSLSPPRHGRD
DSFDSLDSFGSRSQQTPSPDVVLRGSSDGRGSDSETDLPHRKMPDVKKDDMLARRTSHGE
PKSAVPFNQYLPNKSNQTFYVPAPLRKKKAEREEYRKSWSTATSPLGDRPFRFGPRTAVS
DDAESVSMFDMRSEEEAMAQPHSKARHEKLQNIHNQLKEDETRWQDDLARWKSRRRSASQ
DLIKKEAERKKMERLLSGEGTNERRKSIKTYREIVEEKERRERELHEAYKNAKTQEEAES
ILQQYIERFTISEAVLERLQMPKILERSHSVEPNSPLKDPNPLRYLRQQSLPAPKFTATI
EATIVPTTDLEPSGSTGRTSPSKSVVSKAVPMLTPKPYSQPKNTQEVLKNFKVDGKVSMN
GENFNSVEEKDKECTTVIFTQSPSRSLKFDGVASGDRPPMELKKDPTSVELSLQRPATQS
VHREPTFERVCPDQEKKNPFGDQVKCQHLLSGSEQKQFKSTVVCASPVVKSLEFSPSPVP
PEEIAPCEKDVKKPEMEKQKKAALPAMQEVMKPNALEQEGSVVLPFLKKLPETSQVTLHN
SDLQADSGNSDKSNLAFPSHQRFNFWSWDPEEERKRQERWQHEQERLLQEKYQKEQDKLK
EEWEKAQREVEEEERRYYEEERKIIEDTVVPFIVSSNSAELLSSSSSTTEGNKTANASDS
NGSPEEGKPEEVTRQKKLLWEQDSMPSLKNKENERWQEKRSGNKVLSGHPEMGILKGGDQ
EHQVPVMERCSPARLNLPLTQDVPWNQQLLMKQSPQRAEDTRQRPLLGQSAGQQPSSTGE
GRRAGCHENFRSGPSSPCSPAAPSQSPNRSVSGKKLCSTCGLPLGKGAAMIIETLGLYFH
IQCFRCGICKGQLGDAASGTDVRIRNGLLNCNDCYIRSRTAGQPTTL
Download sequence
Identical sequences G1NHX0
ENSMGAP00000012808 ENSMGAP00000012808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]