SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012834 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012834
Domain Number 1 Region: 373-671
Classification Level Classification E-value
Superfamily L domain-like 4.59e-57
Family Ngr ectodomain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 28-319
Classification Level Classification E-value
Superfamily L domain-like 3.13e-55
Family Ngr ectodomain-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012834   Gene: ENSMGAG00000012213   Transcript: ENSMGAT00000013732
Sequence length 736
Comment pep:known_by_projection chromosome:UMD2:1:51647762:51651367:-1 gene:ENSMGAG00000012213 transcript:ENSMGAT00000013732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APSMGLLLLALVLALALGRTVAARCPAVCVCDNLRAHVLCLRQNLTAIPDTIPELTKQLD
LRGNSFKVITAGAFLSTPYLTHLDLSNSQLERVEEGAFRGLGRLLHLNLASNSIAVLYQE
ALDGLSSLQQLILRQNNLEEMQPGAFSRLASLTLLDLRENALVYLPDMVFQGLQSLRWLR
LSHNALHVLGSEAFTALPALRRLSLDHNELQALPSDALARLSEATRLELDHNPITYLAEE
AVAMASLQHLSLEHAALQDVAPDAFSRSPLLRTLDLAHNQLQGLPALVGVGGLVRISLDG
NPLLCSCLLLPFHRWMGRARVQTEGTCVAPPALQGRPLDSLRPSEMKCGQPQVPIPNPTV
PSVQTGGTTSGPCPTGCTCSPEFHHANCENRGLRKIPRGFPTDTQLLDLRRNALGMVPMG
AFLGLKALVSLHLQSCGITELHPGALRGLPSLVYLYLSDNQLSTLVPTAFEGVPQLSYLH
LDHNAFMQVPSGAFQLLPNLFSLHLQHNAIGELAKGDLAGLAGLRWLSLAGNVIRSIGPT
ALAATKMLEKLHLERNSLKEVPTASLHHLPALSELKLSQNPIKHIRDGAFLPVSGSLQHL
YLDNMGLEKISPSAFAGLGPKIKSLHLESNKMSSIPVMSNFTRLEILNLRDVPFHCDCRL
LPLYRWIEKLNLRTGATCASPAEAQGQKVKFSTTFQNCPGWRARGASADKAKAARKPSKR
KRSEKPPSKGFRKNKA
Download sequence
Identical sequences G1NHZ2
ENSMGAP00000012834 ENSMGAP00000012834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]