SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013000 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013000
Domain Number 1 Region: 710-1009
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-79
Family Protein kinases, catalytic subunit 0.0000000000415
Further Details:      
 
Domain Number 2 Region: 329-521
Classification Level Classification E-value
Superfamily L domain-like 7.09e-46
Family L domain 0.00000159
Further Details:      
 
Domain Number 3 Region: 49-210
Classification Level Classification E-value
Superfamily L domain-like 5.95e-41
Family L domain 0.00000501
Further Details:      
 
Domain Number 4 Region: 506-640
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-21
Family Growth factor receptor domain 0.000000991
Further Details:      
 
Domain Number 5 Region: 187-340
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.64e-19
Family Growth factor receptor domain 0.0000000662
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013000   Gene: ENSMGAG00000012330   Transcript: ENSMGAT00000013902
Sequence length 1214
Comment pep:known_by_projection chromosome:UMD2:6:52962332:53001182:-1 gene:ENSMGAG00000012330 transcript:ENSMGAT00000013902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLPLGSCTVDTSVFSTVLMLQLCFLLSSTVCQGTNNKLTQLGHVEDHFTSLQRMYNNCEV
VLSNLEITYVEHNRDLSFLKTIQEVAGYVLIALNMVDVIPLENLQIIRGNVLYDNSFALA
VLSNYHMNKTQGLRELPMKRLSEILNGGVKISNNPKLCNMDTVLWNDIIDTSRKPLTVLD
FASNLSSCPKCHPNCTEDHCWGAGEQNCQTLTKVICAQQCSGRCRGKVPSDCCHNQCAAG
CTGPRESDCLACRKFRDDATCKDTCPPLVLYNPTTYQMDVNPEGKYSFGATCVRECPHNY
VVTDHGSCVRSCNTDTYEVEENGVRKCKKCDGLCSKVCNGIGIGELKGILSINATNIDSF
KNCTKINGDVSILPVAFLGDAFTKTLPLDPKKLDVFRTVKEISGFLLIQAWPDNATDLYA
FENLEIIRGRTKQHGQYSLAVVNLKIQSLGLRSLKEISDGDIAIMKNKNLCYADTMNWRS
LFATQSQKTKIIQNRNKNDCTADRHVCDPLCSDVGCWGPGPFHCFSCRFFSRQKECVKQC
NILQGEPREFERDSKCLPCHSECLVQNSTVYNATCTGPGPDHCVKCAHFIDGPHCVKTCP
AGVLGENDTLVWKYADANAVCQLCHPNCTRGCKGPGLEGCPNGSKTPSIAAGVVGGLLCL
VVVGLGIGLYLRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQAHLRILKETEFKKVKV
LGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRL
LGICLTSTVQLITQLMPYGCLLDYIREHKDNIGSQYLLNWCVQIAKGMNYLEERRLVHRD
LAARNVLVKTPQHVKITDFGLAKLLGADEKEYHAEGGKVPIKWMALESILHRIYTHQSDV
WSYGVTVWELMTFGSKPYDGIPASEISSVLEKGERLPQPPICTIDVYMIMVKCWMIDADS
RPKFRELIAEFSKMARDPPRYLVIQGDERMHLPSPTDSKFYRTLMEEEDMEDIVDADEYL
VPHQGFFNSPSTSRTPLLSSLSATSNNSATTCIDRNGGHPVREDSFVQRYSSDPTGNFLE
ESIDDGFLPAPEYVNQLMPKQPSTAMVQNPIYNNISLTANSKLPMDSSYQNSHSTAVDNP
EYLNTNQSPQAKTVFESSPYWIQSGNHQINLDNPDYQQDFLPNETKPNGLLKVPAAENPE
YLRVAAPKSEYIEA
Download sequence
Identical sequences G1NIB9
ENSMGAP00000013000 ENSMGAP00000013000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]