SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013158 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013158
Domain Number 1 Region: 1-59
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000000223
Family Calponin-homology domain, CH-domain 0.00073
Further Details:      
 
Domain Number 2 Region: 146-174
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000299
Family LIM domain 0.014
Further Details:      
 
Domain Number 3 Region: 116-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000038
Family LIM domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013158   Gene: ENSMGAG00000012490   Transcript: ENSMGAT00000014060
Sequence length 843
Comment pep:known_by_projection chromosome:UMD2:1:50306303:50319062:1 gene:ENSMGAG00000012490 transcript:ENSMGAT00000014060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFDSLSKDNVYENNRLAFELAERELGIPALLDPNDMVSMKVPDCLSIMTYVSQYYNHFNN
PNQARVPPPMKRPAAAASPPLLAHKKPVAAVESSSEPQDDAPVEPAELSQSQRTMLSSTC
TACQQHVHLVQRYLAEGKLYHRQCFRCKECSSTLLPGSYKPGSEAGTFVCTQHRGAEVGK
DNDSVEETVAETQMPAEVPTNPEEKDSTPSRAETAIPCAGSGAPISQIPPRPPLPSKPLV
PSQDKAGSLDGQHRQTRPTPAPRRSTDALSPPASHPVPRPRSTIQGEASDSGPGMVNGRV
PEPSPPVPKPRGRPCSSDRAGGAARAKDPPWMALVQAEPKKKPAPPPPGSGQETPSRTLE
EEDGEEVGKARSEESRSDATEPKSYNPFEEEGDEEEESTAAQKSTPEQEQSETAARPLHP
WYGITPTSSPKVKKRPAPRAPNASPLAHHPISRLSHSEPSSSTPSPALSLESINSESSAK
VLGDTDEASVPKSSSEPTVHTPTATKTSHTDTPLTSVSSSESPAAPASLSTNSSFSSSSE
LASFSAEVQNSTLHASRSVSTGSLKTSPSRLPPKPPAGASPTSMLLASEGGTGSPKPSSS
PKPQLKSSCKENPFNRKPSPVASPSAKKPPKGSKPVRPPAPGHGFPLIKRKVQTDQYIPE
EDIYGEMDAIEHQLDQLEHRGVILEEKLRSSENDSPEDSLLVDWFKLIHEKHMLVRHESE
LIYIFKQQNLEQRQADVEYELRCLLNKPVEKDWTEEDRVREKVLMQELVTIIEQRNAIVN
CLDEDRQREEEEDKMLEAMIKRKEFHKEAETETKKKGKFKPMKVLKLLGNKHDSKSKSPK
EKS
Download sequence
Identical sequences G1NIQ0
ENSMGAP00000013158 ENSMGAP00000013158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]