SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013421 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013421
Domain Number 1 Region: 1-120,151-258
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.65e-76
Family Calponin-homology domain, CH-domain 0.0000305
Further Details:      
 
Domain Number 2 Region: 7823-7948
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-19
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 3 Region: 3317-3463
Classification Level Classification E-value
Superfamily Spectrin repeat 2.23e-19
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 4 Region: 8043-8198
Classification Level Classification E-value
Superfamily Spectrin repeat 2.28e-19
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 5 Region: 6962-7106
Classification Level Classification E-value
Superfamily Spectrin repeat 2.74e-19
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 6 Region: 1581-1740
Classification Level Classification E-value
Superfamily Spectrin repeat 6.19e-18
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 7 Region: 7084-7220
Classification Level Classification E-value
Superfamily Spectrin repeat 9.68e-18
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 8 Region: 7415-7546
Classification Level Classification E-value
Superfamily Spectrin repeat 2.64e-17
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 9 Region: 3101-3227
Classification Level Classification E-value
Superfamily Spectrin repeat 3.51e-17
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 10 Region: 5032-5191
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000209
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 11 Region: 4493-4650
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000245
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 12 Region: 2441-2581
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000705
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 13 Region: 1385-1521
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000984
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 14 Region: 7338-7449
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000183
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 15 Region: 7952-8062
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000202
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 16 Region: 6751-6891
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000236
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 17 Region: 4275-4431
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000304
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 18 Region: 4384-4541
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000461
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 19 Region: 3900-4021
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000104
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 20 Region: 3543-3685
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000216
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 21 Region: 2659-2788
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000235
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 22 Region: 3747-3868
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000024
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 23 Region: 7613-7764
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000288
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 24 Region: 539-677
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000369
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 25 Region: 1696-1848
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000173
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 26 Region: 5698-5815
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000419
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 27 Region: 2229-2383
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000216
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 28 Region: 5914-6054
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000484
Family Spectrin repeat 0.0098
Further Details:      
 
Domain Number 29 Region: 2032-2171
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000196
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 30 Region: 3011-3114
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000071
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 31 Region: 1048-1205
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000106
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 32 Region: 1915-2058
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000107
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 33 Region: 2811-2929
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000183
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 34 Region: 5505-5621
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000756
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 35 Region: 4605-4758
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000374
Family Spectrin repeat 0.02
Further Details:      
 
Domain Number 36 Region: 4945-5042
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000624
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 37 Region: 6546-6630
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000768
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 38 Region: 3466-3579
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000995
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 39 Region: 6675-6788
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000173
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 40 Region: 3232-3327
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000374
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 41 Region: 3986-4120
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000468
Family Spectrin repeat 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013421   Gene: ENSMGAG00000012698   Transcript: ENSMGAT00000014327
Sequence length 8404
Comment pep:novel chromosome:UMD2:2:50486127:50733450:-1 gene:ENSMGAG00000012698 transcript:ENSMGAT00000014327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEQELVQKRTFTKWINTHLAKRNPPMMVSDLFEDIKDGVMLIALLEVLSGQKLPCEQGRH
LKRIHWVANIGTALKFLEGRRIKLVNINSTDIADGRPSIVLGLVWTIILYFQIEELTSNL
PQLQSLSSSASSVESVVSSETASPPSKRKVVTKVQGSARKALLKWIQYTAARQVGIEIKD
FGQSWRSGVAFHSIIHAIRPDLVDMEKVKGRSNRENLEEAFTLAETELGIPRLLDPEDVN
VDKPDEKSIMTYVAQFLKYYPDPHHTVADVQENDELQSIPTFVISFMKFKKEDKLMLRDL
KVWAEQFERDLARAQVAETSLQEKYQSFKHFRIQYEMKRKPIELVTQSLRKDGKLSLDQA
IVKQAWDRVSSRLFDWHIHLDKSLPAPLGTIGAWLYRAETALREEVSIQQAHEETANIIH
RKLEQLKDLLKNIEGHKKTFHEIHGARSVNGVPVPPDQLEDMAERFNFVVSSSELHLLKM
EFLELKYRLLSLLVLAESKLKSWIIKYGRRDSVELLLQNYISVIENSKFFEQYEVTYQIL
KRAAEMYAKANGSVEEVESVMKFMSETTAQWRNLSVEVRSVRSMLEEVIANWDRYSSTVA
GLQAWLEDAEKMLNQTEQSKKDFFRHLPHWIQQHTAMNDAGNFLIETCDETISRDLKQQL
LLLNGRWRELFMQVKQYARADELDKMQKEYLDGVANLTAFIDGSNRKFSAPTEVSFLDVK
IFVQDLENIKQKLPAMEAQYKMVARTAQLVTKEVSQEEVNEMLATLTKIKEQLSKVKENS
CALLYECQHLLSPLEEQEKQITNFYESLEKVNEIISILDPEAQPTTVLKQKAQDLVAYQE
NCKKALSLIERNSQSILQCVASSEVLKHFHHSTFQKKVTQVQITFQNMVRKAGDWRKNIE
VNSRLMKKFEESRAELEKVIQIANCCLKEKGNPEELLRKHSEFFNQLDQRVLNAFLKACD
ELTDILPEQEQHSLQEAVRKLHRQWKDLQMEAPYHLIHLKIEVQKSKLLVTVEECKAELA
RQNKALTREGKERMIEEHKLFFGDKGSYHLCEKRLQRIEELCHKLPVSDPVRATLESSQR
ILKELKSQIDSTYTKLTEHSDIWKSYTNRFSELANWISSTERELKRIKESVNDTAKYEQF
KSSVGEIRQHINKEGENHSWLKSRLAVITKICTDVEAKKTEDELCKLSSDFKGLLDLLAE
IERTLGTVGDCVQYKEEVKTAIEELINNSKEAQAEAEKILDTESLLQAQQLLFHHQQRTR
RLRAKRQGVQQQIFQAKQLQIEGGLPSAMQEDLLKLEGTLENMQQTMEKREEQLQVTINK
WEQFERDKETVVKYLNQASCALERILNFSSLESLSSELDQTKELSKHSEAMAVQAENLVK
NSSEIQLGSKSKHALQQQAKSIQEQVKKVDVTLEEDLKRMEMMKNKWDHFGKNFEALSTW
IAEKEKELETLETPSSPLDTQISQIKVINTEIDGKINGISKLEEEAKSFTQFVTSGECAH
IKAKLTHIKRYWEDLREHAQRLEGTITGKASAQKIYEESLKQVQQSVSEFETKLAEPLTS
CTSSSATYGDLQDCTDLCHTVEKLSNTLASLSACARKAASKEKAAQEVTALQQRYEKVLE
NAKEKQMLLETLLVRWQKQEKELCAFQIWLEGCEAAARPSEQYVSADRVKLEGELQSLQD
LRADFESHASVYASLLQLNESLFPTASKQCVKAIKEKCKELDERWKALPQTIDKRINFLQ
SLVAEHGQFDELLCGFSDWIKQFLAQLQSTSEINTADQELAASHNKNHSMEIESKKQQLQ
NLKDLVNKLCVFSCPEDQQILQGKTEDCFQIFQEANQITKQRQEALDQLQVFLELHNAAS
RVLHQLRQTVEKTGNMDKAKSELLEKDLHDVIQSLNKLESIAISLDGSLTKAQYHLKHGI
SEQRTSCRAVVDHLYLELEAVQNLLGTKQSEAEALATLRKSFMERKEELLKSIEDTEEKA
DKEGLREATLQALQQRLRIFNQLDEDLNSHQHELQWLMDKAKQIAQKDITLAPEIDKEIN
HLASLWEDTKKVIQEKKEQSCILIDLIKEYHSLKSTVMKVIDSADSASVIKSIWKDREDF
RRTLSKHEAAKNDLSDKQKDLDTFTNKGKHLLAELKKVHNCECTVVKMDMDSTVDKWLDV
SERIEDNIHRLNLGVSLWDDILKIADEMDGWCTNCISHLNEGISNLSNSLRMEVILKDFQ
SQVKDKEQKLEQLNSKISELKELTHSQEPPADLQFIESDLRQKLEHAKEMSQTAKETLKD
FNTQKMQLQKFIDKMTHWLTETEETLLRCSRNLDPEALNLVKETQKDLQLQQSSIDSTRE
NLNRLCRKYHSVELETLGGTVTSLLKKYEAVNQLCSRTQANMQECLEKHFLYSMQEFQEW
FSDVKAAVKELSDRSGDSKAIESKTSNKQSVLDSLSEGQNKLDAACKEGENLYTCLPQPV
VIHIQEQVAKTNQNFKEFLSQCLNDKQALEACASYLGSFEEQHKKLSLWIHDMEERMSTE
ALGEIKELIPEKKKEVQKVEKFLEELLASRESCEKLAQIAQALNEEGHGAGREVRLASQH
LTNYQNMVKTVKEKLQTCQLALQEHLTLEEALQSMWSWVKEVQEKLASAESTVGSKATLE
QRLTQIQEILLLKGDGEVKLNMAIGKGEQALRSSNEEGQKMIQIELQRLKDVWNDIISTS
MSWQSVSCLESLISQWNEYLERKSQMEQWLEKLDHKVEQPLEPQLGLKEKFAQLDYFQAI
VSEIEDHSGDLQQLVEKTAELYKKTEDDSFGAAAQEELKTQFNDITTVAKEKMKKVEDIV
KDHLLYLDAVHEFTDWLHSAKEELHRWSDATGDTSVIQKKLAKINELVDSRQIGAGRLGR
VETLAPAAKRSTSAGGCQLLAAEMQALQLDWKQWEESAFQSQRSLRDMLSQMAVSEQEFA
TQVARLEEAVQRFGGLLAAWSQSLTPLDSRHTDTEIVESWRKEKETSDALIKSEHAIDEI
KTQLNDLCRFSRDLSTHSSKVSGLIKEYNSLCLQASKGCQSKEQILQQRFRTSFRDFQQW
LVNAKVTTAKCFDVPQDISEASASLQKVQEFLSESENGQHKLNLVASKGELLCSILPKEK
AKVISDKCAMVKEDWKNFISTLHQRESALENLKIQMKDFEATAEPLTEWLSTTEKIVQGS
SSRLHDLPSKRREQQKLQSVLEEISCHEHQLNRLKEKAQQLLEEQAVSKSFMRRVSQLSS
QYLTLSNLTKEKVSKMDRVVGEHQQFSHDFKDLQDWVADAIHMLESYCHPTADKNVLDSR
MLKLEGLLTLKQEKEIQMKIILTRGESVLQNTSPEGVQVIEQQLHTLKDSWASLLSACIR
CKSQLEGALSKWTSYQDDVRQFTSWMDKVEASMNSSQRQYAELREKTAALSKAKLLSEEV
LSHSSLLETIEVKGSGMAEHYVTQLELQELQERYKLLKDRTRKQEAVKKAEELLNLHQGY
QRNLKAFETWLEEEQEKLSCLSHLEGDAQKQEATLRDLQELQVHCAEGQALLNAAVRARE
EVIPWGVPQIEDRALESIRQDWQVYQHNLSEARSQLNAAVSRLRLMEKKFQKVNDWITEL
EEKVAIRTGRQSGRATKEMQLQQMKKWHEEITIYKDDVEEVGILAQQILEEGLTTSGMGS
QATQLTSRYQTLLLRILEQTKFLEEEIRSMEESELAFSAYKNWYGATNKDFRNVITKFDV
LNKTAMEKKVQKLELLLSDMDIGHSLLKSAREKGERAIKYMEENGVDGLRKEIGDHVEQL
EDLAGSIRKEHVTSEKCLQLAKEFSDKYRAQTQWLTEYQAMLHTPVEPKCELYEKKAQLS
KYKSIQQTILSHESSIKSVIEKGEALFDLVNDMTLKNNIQDLQSNYHELCSATKACVETL
EVRVKEHEDYNSDLQEGEKWLLHMSSRLVSPDLMESNSLEIITQQLANHKAIMEEIAGFE
DCLDKLKSKGDYLISQCTEHLQAKFKQNIQSHLQGTRDSYSAICSTAQRVYQSLEHELQK
HVNHQDTLQQCQTWLSTVQSELKPSTWAPFSQADAVKQVKHFRALQEQANTYLDLLCSMC
DLSDATVKSTATDIQQKKQMIEQQIMHSQYLAQGWEEIKQMKAELWIYFQDADQQLQNLK
RRRAELELNIAQNMVLQIKEFSQKLQCKQSALTSVTEKINKLTQGQESPEHKEIGQLSNQ
WLDLCLQAHSLLIQREEDLQRTVDYHDRMHIVEVFLEKLTKEWDNLARSDAESTNVHLEA
LQKLALTLQERRFALEDLKDQKQKMVEHLNLDDKELVKEQFGHFEQRWTQLEELVKRKIQ
ISVSTLEELSLVHSKLQELMEWAEEQQPSISEALKHSPPPDLAQSLLMDHLTISSELEAK
QLVLKTLLKDAERVMTSLGLNERQELQKALSDAQHHVDCLSDLVGQRKKHLNKALSEKTQ
FLMAVFQATNQIHQHEKKVTFPEHICLLPEDVNKQIRTCKSAQASLKAYQNEVTGLWAQG
RDLMKEATEQEKSEVLGKLQELQNIYDTVLQKCTQRLLELEKNIVSRKYFKEDLDKACHW
LKQADIVTFPEVNVMNSNSELYTQLSKYQQILEQSPEYENLLLTLQRHGQEILPSLNEVD
HSYLDEKLNILPQQFNTVSALAKDKFYKVQEAIYARKEYTSLIELTTKALTELDDQFISM
DKAPAAVLAKEALALQQAYKDLLDEVMSLGAAVDELNQKKEAFRSTGQPWQPDEMLKLVT
LYHKLKRQIEQKINLLEDTVEVCQEHEKMCTQLEAQLEAVKNEQIKVNEEMLPIEEKLKI
YHSLVGSLQDSGSLLKRITEHIETLSPQLDPSARETTNHQVLLWQDKLKNLHAAIGDIVM
DCENRLVQSIDFQTEICRSLDWLRWVKTELSGKLSLDLKLQSIQEEIRKVQIHQEEVQSS
LRVMNALSNKEKERYMKAKELIPADLENTLAELTELDGEVQEAIRIRQATLDKLYSLCRR
YYQVIQITNDWLEDAQEFLHLTRNGLDVENSEGNLGNHIEFFSTESQFSNNLKELQGMVP
ELEPFIHATAREQLMQNLALLEEKGKGTKQEANNQQELLQRCASKWQEYQTARQKVIEVM
NEAEKKLSDFSVAKASSSHEAEEKLQTHKTLVSVVNSFHEKITTLEEKVSQLEEVSSDTS
KATVSRSMTTVWQRWTRLRNVAQEQEKILEDAVQEWNGFNDKLKHFSSKSRHPLNFTGRF
STWANRIHFKIIPCDYMNIYINLKLQVSTSEAVNSYCLVSSEIWASLRSISFWPILEVYF
GIGDESFLSMQQKVKNSVKLVKQELKDREEVEAQINVVKTWIQETKEYLLSPNVELDTQL
QELKSLFCEVTTHRQAVEKMAEQQQNKYLGLYTILPSELSLHLAEVGLALVTVQDQIQDK
EKETGHIKALNQEFEQQIQEIANELNAILSKLKRKTDDIVQAKLEQKILGEELDSCNIKI
LELDASVQEFSEQNIPLAKQLANRIGKLTALHQQTIRQAEYRATKLSQATSHLEEYNEML
EFILKWIEKANILVRGSITWNSSSQLRDQFKAYQTMLEESGEIHGDLEAMSERIECLASV
YSTEGMSQQVLELGRRTEELQQIIKVRLPNLQDAAKDMKKFEVELRALQAALEQAQATLT
SPELGRLSLKEQLSHRQHLLSEMESLKPKVHAVQVCQSALRIPEEVVTSLPICHSALQLQ
EEASRLQHTAIQQCNIMQEAVVQYEQYEQEMKHLQQMIESAHREIQDKPVATSNIQELQN
QISRHEELAQKIKGYQEQIASLNSKCKMLTMKAKHATMLLTVTEVEGLSEGVEELDSDLL
PAHPAHPSVVMMTAGRCHTLLSPVTEESGEEGTNSEISSPPACRSPSPVANTDASVNQDI
AYYQALSAEQLQTEAAKIQPSTSATQEFYEPGLESAASAKLDDLQRSWETLKNVISEKQR
TLYEALERQQKYQDTLQSISTKMETTEMKLNESLEPAKSPESQMAEHQALMDEILMLQEE
ITELQTSLAQELVSESLDAEAADQLALQSTLTVLAERMATIRMKASGKRQLLEEKLSEQL
EEQRQEQALQRYRCEADELDHWLLNTRATLDTALVTAEEPMDMEAQLVDCQNMLVEIEQK
VVALSELSVHNENLLMEGKAHTKDEAEQLALKLRTLKGSLLELQKVLHDKQINIQQGSLQ
EKEESNLDLVSSQSPSVQEWLAQARTTRSQQQQSTLQQQKELEQELEEQKNLLRSVACRG
EEILTQQGTPEGLLSHYSEKPEKLSEELCLEGEKSSPEQQLKIKWESLNHKFSTKQKLLQ
KTLEQEQLQIYSRPNRLISGLPLYKENGQDEEKSSVSPVLVELNQAFEDASSETGHVEKE
SLHLEQKLYDGVASTSLWLDGVEEQVFVATALLPEEETETYLCKQENQSLAKEIKDITEE
MDKNKNLFTQIFPENGDNREVIEDTLDCLLRRLTLLESVVNQRSHQMKERLQEIMTFKND
LKLLYTSLADSKYLVLQKLAEAVEKPETEQIQVIMQAEESLKELDAGISELKKSVDKLQI
DQPSVQELCKLQDMYDEVMMIIGSRRSDLNQNLALKRQYERALQDLADLVETGQEKMDGD
QKMIVASKEEVQSLLNKHKEYFQGLESHMILTETLSRKMSSFALLKEIQSHPELMTQAST
VLKLAHKRGVELEYILETWIHLDEDYQELTRQLESVEGSIPAVGLVEETEDKLIERIKLF
QHLRSNLTEYQPKLYQVLDDGKRLLFSVSCSDLESQLNQLGEHWLSNTSKVNKELHRLET
ILKHWTRYQSESIELTHWLQSAKERLEFWSQQSLTVPQELETVRDHLNSFLEFSKEVDAK
SSQKSSVLSTGNQLLRLKKVDTAALRAGLSHIDSQWTELLTHIPIVQEKLHQLQMDKIPS
RHAITEVMSWISLMENVIHKDEESIKNIIGQKAIQDYVQKYKGFKIDLNCKQLTIDFVNQ
SVLQISSQDVESKRSDKTDFAEQLGAMNRRWQILQGLVTEKIQLLESLQESWTEYENNVQ
CLKSWFETQEKKLKKQQRIGDQASVQNALKDCQELEESIRTKEKELESIEKSGLSLIQNK
KEEASSAVLNTLQEINHSWASLDHVVSQLKILLQSVLDQWSIYKVTYEELNSYLMEARYS
LSRFYLLTGSLEAVKVQVNNLQSLQDELEKQENSLQKFGSVTNQLLKECHPPVTETLTNT
LKEVNMRWNNLMQEIAERLRSSKGLLQLWQRYKDCYQQCSSTVRLREDQTNELLKTATSK
DIADDEVTTWIQDCNDLLADIKTAQDSLIVLQELGEELKSRVEASAAAAIQSDQLSLNQN
LSALEQALCKQQTVLQAGVLDYQTFAKKLQDLEAWVTEAEAKLKGQDPGHASDLSAIQSR
MEELKSQMLKFSSMAPDLDRLNELGYRLPLNDKEIKRIQNLNRQWSLISSQTTERFSKLQ
SFLLQQQTFLEKCETWMDLLVQTEQKLAAEISGNYQSLLEQQKAHELFQAEMFSRQQILH
SIISDGQRLLEQGQVDDRDEFNLKLTLLSNQWQGVIRRAQQRRGIIDSQIHQWQRYREMA
EKLRKWLVETSCQPVSGLGNAPIPLQQARALLDEVQLKEKVLLRQQGSYILTVEAGKQLL
LSADSGAEAALQAELTEIQERWKKVSTQLEEQKKQVTLLLKDWERSEKGIADSLEKLRSF
KKKLSQPLPEHHDELNAEQIRCKELENAVDGWTDDLAHLSLLKESLSTYISADDISVLSE
RIELLHRQWEELCHQVSLRRQQVSEKLNEWAVFSEKNKELCEWLTQMESKVSQNGDIVIE
EMIEKLRKDYQEEIAVAQESKIQLQQMGERLAKASHESKASEIEYKLGKINDRWQHLLDL
IAARVKKLKETLIAVQQLDKNMSSLRSWLAHIESELSKPIVYETCDSEEIQRKLNEQQEL
QRDIEKHSTGVASVLNLCEVLLHDCDACATETECDSIQQATRNLDRRWRNICAMSMERRL
KIEETWRLWQKFLDDYSRFEDWLKNSERTAAFPSSSGVLYTVAKEELKKFEAFQRQVHES
LTQLELINKQYRRLARENRTDSDCSLKQMVHEGNQRWDNLQKRVTSILRRLKHFIGQREE
FETARDSILVWLTEMDLQLTNIEHFSECDVQAKIKQLKAFQQEISLNNNKIHQIIVQGEQ
LIEKSEPMDAAVIEEELDELRRYCQEVFGRVERYHKKLIHLPLTDDEHDLSDKEVDLDES
ADLSDIHWHEKSADSVLSPHPSSNLSLPLAQPVRSERSGRDTPASVDSIPLEWDHDYDLS
RDLETAVSRALHSEEEDGEQEKDFYLRGATSIAGEPGALEAHIRQLDKALDTSRFQIQQT
ENIIRSKTPTGPELDATYKGYMKLLGECSGSIDSVKRLGYKLKEEEEKLSGLINLNSTET
QTAG
Download sequence
Identical sequences G1NJC5
ENSMGAP00000013421 ENSMGAP00000013421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]