SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013658 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013658
Domain Number 1 Region: 397-701
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.1e-54
Family Rhodopsin-like 0.00042
Further Details:      
 
Domain Number 2 Region: 24-251
Classification Level Classification E-value
Superfamily L domain-like 6.8e-30
Family Ngr ectodomain-like 0.0000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013658   Gene: ENSMGAG00000012948   Transcript: ENSMGAT00000014570
Sequence length 761
Comment pep:known_by_projection chromosome:UMD2:5:42531833:42580169:1 gene:ENSMGAG00000012948 transcript:ENSMGAT00000014570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWLPVAFQLVLVLCSQGTERCPSAFCECSDWDDYKITCRDIHFIPSLPEDTQTLRFMET
HLRTIPGEAFSNLPNISRIYISIDETLRSLEAHSFNSLSKVTHIEIRNLRNLDYIDPDAF
KNLPLLKYLGIFNTGLKVFPDLTKISSSDVNFLLEIADNPFMTSVPANAFHGLCNESLTL
KLYNNGFTSIHSHAFNGTNLDAIYLHKNKYLKVINEDAFLGVHSGPTLLDVSRTVIVNLP
VKGLESLKELMAQNTWTLKKLPAVKIFLQLIRADLSYPSHCCAFKNWKKNSGILEYLMCN
QTGSHSFRNRRSLRAIREPFYKDHTEEYTDRTDSVYDKNTKFRNFHENSQYYIFLEEHGE
ENVGFGQELKNPQTEDMQAFDSHYDYLVCGGNEDVICTPEPDEFNPCEDIMGYQFLRIVV
WFVNLLAIVGNVFVLFILLTSHYKLTVPRFLMCNLAFADFCMGLYLLLIASVDLYTRSEY
YNHAIEWQTGPGCNTAGFFTVFASELSVYTLTVITLERWYAITFAMSPNRKIRLRHALVI
MLGGWLSCFLLALLPLVGVSSYSKVSICLPMDTETPVAEAYVVFVLICNIIAFVIICACY
IKIYITVRNPQYKSGDKDTKIAKRMAVLIFTDFLCMAPISFHALSAIMNKPLITVTNSKI
LLVLFYPLNSCANPFLYAIFTKAFRRDVFILLSKFGICEHQAQVYRGQTISVKNSSGSYG
QRISRGLGQILTSIQDPVNDYLPAMTMQNQILVEECKQTEL
Download sequence
Identical sequences G1NJV7
ENSMGAP00000013658 ENSMGAP00000013658 XP_003206698.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]