SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013778 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013778
Domain Number 1 Region: 103-341
Classification Level Classification E-value
Superfamily L domain-like 6.73e-49
Family Ngr ectodomain-like 0.086
Further Details:      
 
Domain Number 2 Region: 5-140
Classification Level Classification E-value
Superfamily L domain-like 1.06e-27
Family Leucine rich effector protein YopM 0.021
Further Details:      
 
Domain Number 3 Region: 771-867
Classification Level Classification E-value
Superfamily PDZ domain-like 5.13e-26
Family PDZ domain 0.00011
Further Details:      
 
Domain Number 4 Region: 638-733
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-24
Family PDZ domain 0.0000519
Further Details:      
 
Domain Number 5 Region: 949-1005
Classification Level Classification E-value
Superfamily PDZ domain-like 2.26e-16
Family PDZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013778   Gene: ENSMGAG00000013058   Transcript: ENSMGAT00000014693
Sequence length 1521
Comment pep:known_by_projection chromosome:UMD2:3:100195856:100339180:-1 gene:ENSMGAG00000013058 transcript:ENSMGAT00000014693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSQPFFRLLNLRKLGLSDNEIQRLPPEVANFMQLVELDISRNDIPEIPESIKFCKSLEIA
DFSGNPLSRLPEGFTQLRSLGHLALNDVSLQSLPNDIGNLANLVTLELRENLLKTLPTSL
SFLVKLEQLDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRLVCLDVSEN
KLEQLPNEVSGLVALTDLLLSQNLLECIPDGIGQLKQLSILKVDQNRLTEVTESIGDCEN
LTELILTENMLTALPKSLGKLTKLTNLNVDRNRLTSLPAEIGGCANLNVLSLRDNRLALL
PAELANTTELHVLDVAGNRLQNLPFALTNLNLKALWLAENQSQPMLKFQTEDDEKTGEKV
LTCYLLPQQPSPSLENLLQNSVDESWTDTNLNRVSVIQFLDDPKGDDEEESGAERRGLQR
RATPHPSELKVMKKVIEVRRSEVSAAKPGADLNSSSSEEKRLSATSNRSEDSHLSNSTVS
ADCRAEEQGEERQRSRPNGQVLEMQELEDEDVEVEYNEPTVHFAEDTLIRSEDEDEDEER
PFPVEKQRLIRKDTPHYKKHFKITKLPKPEAVVALLQGLNSDGVPKEEEELGGCNNNAEP
EDEEEAWDEDDRKNGSLSAQPSVKGVSFDQANNLLIEPARIEEEELTLTIVRQTGGLGIS
IAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLEVNGVSLHCAEHHVAVEALR
GSGSSVSMTVLRERMVEPENAITVTPLRPEDDYSPRERRGGLRFPERPEGAPPTERYSTC
LMRNEKGLGFSIAGGKGSTPYRAGDTGIFISRIAEGGAAHRDGILHVGDRVISINGVDMT
EARHDQAVALLTASSPTIVLLVEREAAEQLRGSGIPAALPQPSPPPQPNAANGRAAAQIL
FLLSPSELEITLENIAVFKASHSLSSGSTGGSYSGAVPKALTSCSPFPRKVIPRGLASRS
GLRVGDRILEVNSIDLRHATHQEAVNALLSNSQELSVLVRRDPPPPGMQEICIEKAPGEK
LGISIRGGAKGHAGNPFDPTDEGIFISKVPGHKFCDAVHALRGRTMIPETMSHSRGKATS
LGILGGLRADCRVVVVICCELNKDLTASVDFVGSAPSAVTFPYSRRLIRRSLWRSVLHVI
ADMRPQQVSLVFKKVRQQKETLISQYAEKEEEVRNSLTEMEAKYSLMNNLCRSPLATAAA
VSMAGSALALRTDSSKGSAAKTPADRPESAGPKPDTQTKPGVIQPLSRVRQNAASHNPEE
GDSPNPFQQPEPSSSVHNSSTDLFQPRNKHPWGPKPAPEVPTQSGLHSPEQRSFRERQKY
FEVEVKQQQVDKPPKRVSLVGEDDLKKMKEEEVKLLFRHGLEGTVNEKKEKRESEPLGKQ
SAPTASNSGLPIEGTDKMETLCSPLLQVCVTLSPRFSSTPPMLRIEEKSSEVNENNSSQR
NSLEEGMKAEQRTNSMSGLSPLSLAAGDALAPVRTAKAERRHQERLRMQSPELLSSQEKE
LSPAERRALEAEKRAMWRAAR
Download sequence
Identical sequences G1NK59
ENSMGAP00000013778 ENSMGAP00000013778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]