SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013949 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013949
Domain Number 1 Region: 6-128,162-269
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.9e-74
Family Calponin-homology domain, CH-domain 0.0000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013949   Gene: ENSMGAG00000013212   Transcript: ENSMGAT00000014869
Sequence length 334
Comment pep:known_by_projection chromosome:UMD2:5:48027705:48040774:-1 gene:ENSMGAG00000013212 transcript:ENSMGAT00000014869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIFVVERENVQKRTFTRWINLHLGKCKPPLKVRDLFMDIQDGKILMALLEVLSGQKLMHE
YKSSTHRIFRLNNIAKALKFLEDSNVKLVSIDAAEIADGNSSLVLGLIWNIILFFQIKEL
TGNLNRNSSSSSLSSGPSGPESDTSYPSTPNIERSMSVTVKDQRKAIRALLFWVQRKTRK
YGVAVQDFASSWRSGLAFLAIIKAIDSTLVDMKHALGKPARENLEDAFSIAQNKLGVPRL
LEPEDIMVESPDEQSIVTYVAQFLEHFPELEGEDFTDPEKELPIESTYVHIKDTPSEKES
KILILRESDKNMYTVNHERSHPAPPKVHIHDTPE
Download sequence
Identical sequences G1NKJ1
ENSMGAP00000013949 ENSMGAP00000013949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]