SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014271 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014271
Domain Number 1 Region: 389-624
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.53e-38
Family Calponin-homology domain, CH-domain 0.0000935
Further Details:      
 
Domain Number 2 Region: 87-241,386-469
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.15e-19
Family FAD/NAD-linked reductases, N-terminal and central domains 0.078
Further Details:      
 
Domain Number 3 Region: 1017-1050
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000133
Family LIM domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014271   Gene: ENSMGAG00000013503   Transcript: ENSMGAT00000015199
Sequence length 1093
Comment pep:novel chromosome:UMD2:1:63400515:63436166:-1 gene:ENSMGAG00000013503 transcript:ENSMGAT00000015199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESKNEKVNQAHVLFDRFVQASTCKGTLKAFQELCDYLELKPKDYRSFYHKLKSKLNYW
KAKALWAKLDKRGSHKDYKKGKACANTKCLIIGAGPCGLRTAIDLSFLGAKVVVIEKRDA
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILLKVALILGIEIHVN
VEFQGLVYPPEDQENERIGWRALVHPKTHPVSEYEFEVIIGGDGRRNTLEGFRRKEFRGK
LAIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQDLREATGIDLENIVYYKDDTHYFV
MTAKKQSLLDKGVIRHDYADTELLLSRENVDQEALLNYAREAADFSTNQQLPSLDFAINH
YGQPDVAMFDFTCMYASENAALVREQNGHQLLVALVGDSLLEPFWPMGTGIARGFLAAMD
SAWMVRSWSLGASPLEVLAERESIYRLLPQTTPENVSKNFSHYSIDPATRYPNINVNFLR
PQQVRHLYNTGDLKDIHLEIENFVNSRTPKLTRNESVARSSKLLSWCQRQTDGYAGVNVT
DLTMSWKSGLALCAIIHRYRPDLIDFDSLDEHNVEKNNQLAFDIAEKEFGISPIMTGKEM
ASVGEPDKLSMVMYLTQFYEMFKDTIPSSGKDSVDLNAEEKAALIASTKSPISFLSKLGQ
SISRKRTPKAAVQDKKEKELDGAGKRRKTSQSEDVIKSFRNRKFHSYLSCSLSAAIGNQN
KVKSMATQLLAKFEENAPEELLMKKKMRSKERSRTCPKKVIMLSSSTPPSSPPYPRLQAA
AVPETSHTFSRNYTIVLAQGLMTSQRYRDPDAGYPGEQSPRQERMTKCLRMLNKGHVSWL
PSWSPDLTALIVSLMNASVIQNSVINRVKSSLQASEHMLKNELDSRSNHLTVLVYQSVAP
QFYLLLEVFLHIYPETEPSRRFFVDHLRSSNRPSSPSSDSLRQKFKDPEAPADTHFRPSS
VTANMPRFLKILKYIKMYTGGVSSLAEQIANQLQRKEQPKTLLDKKELGSLKKEFPQNLG
GSDVCYFCRKRVYVMERLSAEGKFFHRSCFKCEYCATTLRLSSYAYDIEDGKFYCKPHYC
YRLSGYAQRKRPA
Download sequence
Identical sequences G1NL95
ENSMGAP00000014271 ENSMGAP00000014271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]