SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014297 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014297
Domain Number 1 Region: 21-144,176-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.44e-68
Family Calponin-homology domain, CH-domain 0.0000404
Further Details:      
 
Domain Number 2 Region: 6112-6228
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-18
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 3 Region: 6178-6333
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-18
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 4 Region: 5959-6084
Classification Level Classification E-value
Superfamily Spectrin repeat 8.92e-17
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 5 Region: 4895-5035
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000156
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 6 Region: 6542-6656
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000777
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 7 Region: 5743-5900
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000003
Family Spectrin repeat 0.0095
Further Details:      
 
Domain Number 8 Region: 5211-5359
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000533
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 9 Region: 5651-5790
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000877
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 10 Region: 6649-6768
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000144
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 11 Region: 5576-5690
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000288
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 12 Region: 5113-5214
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000199
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 13 Region: 1989-2119
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000552
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 14 Region: 1468-1625
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000638
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 15 Region: 1872-2012
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000447
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 16 Region: 2725-2827
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000196
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 17 Region: 3720-3870
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000389
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 18 Region: 5048-5149
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000468
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 19 Region: 2211-2337
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000111
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 20 Region: 5323-5460
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000137
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 21 Region: 4815-4928
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000301
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 22 Region: 3302-3452
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000312
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014297   Gene: ENSMGAG00000013516   Transcript: ENSMGAT00000015225
Sequence length 6888
Comment pep:known_by_projection chromosome:UMD2:5:55388078:55539914:-1 gene:ENSMGAG00000013516 transcript:ENSMGAT00000015225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCFPQLPDKGGSYFLGTISHLSFKMQVQRECTQKKTFTTWINSILAKHTPPSVISDLYTD
IQQGHMLLDLLEVLSGQHLPREKGCNTFQCRSNIENALTFLRSKSLKLINIHVADIIEGK
PSIVLGLIWTIIFHFHIEELARTLACTYNQPSLECSSTVDSSPKARRSAKKSAKIKERWK
ISATKALLFWAKEQCSLCGSISVNDFKSSWRSGLPFLAIINALRPGLIDLEKAKARSNKE
NLDEAFRIAELELNIPRLLEPEDVDVMNPDEKSIMTYVAQFLQCSRNMPETEDMQGKVTE
TVSWLAVQGKKLANLLMDTENETYYQKYKEMMSFMEAFNREKKAFLPLLSSKRSGAELSE
GQQQMREEWSKLISQINEWKAQLDQMLPPPLDGIEAWLQKVEHLQAEDLPDLQDPFKAMS
LFSEIISVFKGLMNCFDSHLETLQSFENKDENNMPLVVPEKLEEMKRRFNDIRFTNSSSL
LEYHYGLCSAFANEVTLKLNIWDVKYGTKESVESLLENWNNFIKEKRLKTQLETAADICE
DLKNKNISNLDLEISKLFKTVESKISMCKDYISNVNTTLQKVLSSWSSYTEKLYLLKTWL
EEKQNEYPIEVPAEVLANWNSVHASLNEAGNYLIEVSKEQVGSNIAKELKKLNRKWAKFI
KKTRFVSQLSISSFKTRGTENTQRYPIRKSLPLSISVGDELNENVNKLGEENTDTAEKAR
ELPGGMEKIEELLGSVESWATETECLLSETGHKTPVEPQMEEYLQSLAAKGISYQEQVLA
VEEILQSLMKNASSQVSQQHCHTTGLPARIKEARDRIEAVMGDMNNILPKSEKKPSQREA
LLNFEESQKDIEVSISKAVELVSQKLSREVHISRYEEAFNALDNKVLDNFLKAVEQLKSI
SSDQEKLAVEEKSEDIRKRWEAAHNEIISCVQLLLEREKKKFNTTFKKINKQLGKEKKLL
NMNKTKGLIKEHEAFFSHEGSLKELSKSLEDLKILGKLAEETVPDLQTFAADSEQKLEKL
QQTVADTYTALLSHLKFLLNHRSSIVASENGEKPSSTQQIDILSVQETSRPSEDMALETD
MKHHNGESCEKMFEEGSDSPTPALLESYNTQRRNLEELLQVSRDKVASGFTDEIKGTSCL
QNKLLELQMVENDINSGWAQLGNISSTLENLVDEVKQAAISETRGKLEGELKELQDIIST
RTNSLRTALEIVLPIENESILLCELDQRLNKKGIQQFNLVNSDLAYGELKELQRSILNQI
EVCKQLEHLDSSARDEFNPIDLQAASKIMFYYQNQLEEMSHKMQIRETVLKDLEAFMASL
RKIKSSVKHLIDPLGKPEIQGKTRREAAQELSHMAKEAQCLDERLKTVDICLEDAECGRN
TSCEKLLQTLSEELNVTGDHSSEQMLMEGNDLYRVFSTRNEELLKNIQDLRDRINKIGLK
DPTVPAIQQRVKSLMELEKELDCSAVEMKSMREIANKLLQMEEEKAEESNEQCRVTERSW
EDTKLLLAECQEQCTRALELLKQYQSCKSSLTSIIHKQEIVLSQQNSYMGKDNLNRLITK
IEEAKEEFNDHAEDVDKINQICKNLQFQLNKMRSFEEPPFENEANIIVDRWLDINEKTEN
YCDNLGRAQALWDKLLGLSGTIDAWANAELKNTEGRCLTDEDLTQLKACLSVQEQKLQKF
DNTVAEIEELLNSNEPPLELQVIRSSIVQKMELIKDLLTAKRRTSELSVNTAELKGDLDL
AKTQIGMTESLLKALSPSDTLEIFTKLEEIHQKILQQKHHVTLLQEETDCPDVDELNKQL
KCVTDLFNKKKHVFQDHFIGVLNRQCKNFNDWFSSTQLSLKDCFDPSETKQMLEEKLQKL
KHFFTSEGKDGDIQEVKTLLNKVKHYLPKASINQLSSRVRDQEAELQRLISKCQKREKEL
GTSLQQLNSLQESNTVLEKWLTTQEEKLHEIKKDEIKLENLYKTLLMQREPFDSLAQLAN
SLRETGLTEDEIISETSSLVSRYQTLMTNVNEMAGNTQGLAVDENFKELTQDMSNWIKKL
EKAINNLSSQESELAPDERINQIKEIMALKDAGDAKIQNIVSVGEMLIRNDKIKKPEIQQ
TVSDLQNQWERTCQLATAYRSPQEQLLFNREQYEQSKDDLRLALTELKKQHQEMDFALQP
GLLEKQAQLASYTKLLQKAEDLTSQLNELESRDHVQSFAENPRFTEESWLELKHQHENLL
SQLQAAVETLERHVQEHQQFQDMVTVLNTEIKTVSKKLADYVSPTVEQTSTEQKQLKSQE
QEAPLCQFEDMLKKILVLAETVKQNTSSPGQKFIEDEIETLQSEHRSLEEKLENVKQKKE
NIFSEALELKDDLTDGVQMENKLKREMQIISDTPVAAEEGTTTAELRECLEMPTKEGAAG
VDQKELFPGVQVNTEYFEEEQKVNKLKNEVAELDIVLINEQLKELENLQTELETWKAKSL
CLSQETFPDATRSNGAELQSPEPVVPCWDRLLQELDAVKAVKQQQSCLVNEYQKNLSAAQ
SSMKNLATEKDNIKMGPMNNTVLLEKIKACVQSLHKERDVLNRLKTQQELLSQHLTCMDK
VLTASKMRQLEQWWQHMEQAVQKKHDQVLAEINEFNTLMDKAQDIQRLIQEQYLQTESCS
SAGEKAKCPIIWTAELQNIKHGLSLLKRKIELQMQRIWSDEEKIALESCIQDLQSKLEAL
SEQHTPQDEVRVTGPAVKKQDIMKKLKENVSWVKDSLSSLDQKAALFPCDVKSQIRNCEL
MRNEVLDREPVIEALGNELQHILPNLKPEEISDMTFLLQALQNSYKALVLKSVERLQHLQ
LQLEERQRLTAEVEKVHCQLRNAEALGRPDMNQTSTCSELISQQDILKEILKDVQEIEGL
ISSHCEESQITAGELSLSEQLFLIDQLRSLKNRARKTQRQIQSKCHEVGKKIAVYREFAE
GITSLQKDLSDLQCSELKLEEELTGATQEVKNKCKALKEKVLSFQSNLSQIMKFKEIFEC
IGLNWDSFQLDELHELQTQFFKIRNKIKGKITHFGNVIRECDKFHALLNEIRTMTSAVRK
EANILSDRSNSSPAENLVSAQILLQTVQQILYLIQEVENQINKNEVFHTLFKESKRQEIK
SLETDVEELNLFLQNLVSSLQCVNKEDIQNVAEHLSHAIRHVQLELQQPMVVDMKMMQYE
KMRWESIQNMMSAEFSAIKCIMEKERGSQEEKSLAAGVETKLRALADHEIQLKTDIAARV
SALEEACKAGELYTKAVERAAKFLEDCEAQVRSAAVELSSSEDAYQTPQWKQEEFDSAKA
DIEQLYSKLKNLVKPEDKICLENTLRELINKSLALKGKIQRNEADKQSYLEKYKSYSKCK
DKVCDDLNNLGKMLGQSLSQTPMSYKEALENLQECKILVSNIDSAEDDLVKLRQVSGELM
RLCKGSDRALGRIVTALWENWLGLLEAAKELEINCEELKQEWKFINEELEREAIILDKLQ
EEQPESLKEKEKATREELVELLDSVYAFEENISRQQLLLLLLLHRIRNILNTPENVEAET
ALPALCEIKTMQDRCKKLFEKTQDRKNLIQSEIQERSKITEEINAVKNALQNALSVLSQD
AVGKAAQLKEVQSVIDKESQNLKDIMEKLRIRYSEMYTIVPAETEAQLEDCKKTLQDLED
KISFENLQSSPQYVLKGKAETINNGLQAIEKMLEQKTESVAKAKEVQKQIWDMLDLWHYK
LNELDAEVHDIVEQDSCHAQELMDILMIPLQHYQQVSQLAERRTAILNKAANKMEEYDEL
LKDMKVWIENTNSLLRAGAQNDSAKRLHKYTDGLQMALEDSEQKQNLLHSVYLELEELTP
VFETDSIMQQLNEAEEEVATLQQEIAEILPQIQHVADELDAIESHVKMFEKDVMKMKTIL
SSEDLLELSPKDQLKHGQVILDHIGPMQKTIVHIQSYEEDLQLPGVKKQPVSVFRRARQL
LRELKKIEKITKEQNELLEEAVKKTEECEQEIEKLKQFLKNNLAEKSHEYQPHTQKTSCP
EFQGEMEAIKEEIIKLCQRKEDILTGMKNSMSELHQRLQEEVPEPGDEPTASAFGDSIGT
DVSDVQLKKRGLMSLLPCLDEESEDAFHSKQEKGSTVTEIDVSFWPSLKYKEKHKEDSAT
SWSSGTLSDGGAQVMNSAVIHSINSWGGSKMKRDGVLSAPFASKGDESVTPPPVPNATQG
PRGKEGDPEEAVDGGRPEPGTILQACKAQVAELEQWLDKTKVSLGSDPQTPKMQQMVELQ
LGDFQVMLSEIEQKVLSLLEDGGNSAGHQQEAEDLSLKLKEVKCNLEKVQMMLQDKYSEE
QIPNRERIDPESLKMLHSNGSSMPQLGLAEQPFLQQNGFQHPQDLKVKAAEQKSLIDFIE
SCVEKMQPQFEDSVKSEPRYKATKSLPRFSNGESDPKSKKADPTLAPKDQTGNKWQYLQQ
ELSSKMKSPLCQLVEPQITTKLNMLPRGVFPNAGASTVEELKTYTVQLGDLSQEANVVHA
QENVAEEVSSNLDKKLFELLLAISRCLDNMEEMLNTSVLSTEEAAVQQVLYETLSVELQK
LHADLSDKKDDLLKSITCAGGSTDVFCECFNNLQAWLEQTQAATASRSNSVKAGLDHNTS
YQNETRLLYDQLTEKKATLQQCLNAIRGHNVSEQLQKTDACTLELQNFENQVAKLRGYGE
RFQLPVTLIQEAYKLEDVLDDMWGILKAKYVELNSPSISESQYEDLLCGFAELVAIGQEK
IAQDAKQLTKSRAALQSHLENHKDFFHNLMTHMAFMQAFSKKVNPSVLQKRENFWTGLVN
EVKLLEQKASQYGIRLENLLKEWTEFDDECLAFNKELEALTSTLPSVNLVEETEERLMER
IALLQQIKNNVDEKHARLYQMVKEGKKLLTAVSCPEITNQIGKLEEQWLSLTKKVGNELH
KLQTLLKLLVSYNRDSEELRKWLDSAEQRMKFWKEQSLNVSQDLPTIRDNMDSLFTFSKE
VDDKSSLKSSVVSTANQLFHVKQADTAGLRSSLAKFEQKWGELITQLPAIQEKLHQLQME
KLSSREAIAELMTWLDHVEQQQGHEEPINAQSSVAQVRSLLQKYKEYVMEMNFKQWMVDF
VNQSLLQMSTCDVESKRYERTEFAECLGEVNLRWHRLQASLNRKIQDLEHLLEDATENEN
KAQTLCNWLEAQSDRMRSLQTPASLISAQNTLDDCKDLENQLAMKSKMLDELKQSMSLNG
GTEQTPEVLSFRIADLCEMKDSVVSQVAQLKVSMQSILEQWKVYDDIYAEVSLLMTRYLY
CIDQCKPSVPSLEALKNQVKTLQSLQDELENSEESWAKLQVAANNLKKNCSPSFAEIIDQ
KCTEAHTRWSSVNEDITDQLRTAQATLQLWEPYDSLCTEAAAKLQQHEEQCTQLLDARMP
EDNMIETLKQRIQDVKNLQNGLQNIVGCRSQISELADQIKQQAGTAAQAVLLEKLQPLQR
ASYLEKMLQRKLDELEFNLLQLEDFKNCLETLEGHVKNCTDAFDSLHLEGETDNSELLMN
HTLELAALSPSIESLNEASIKLPVSDFILKKMQSLTRQWSQKTATALEHCSVLEGTQTDE
KKFLQKCENWMKFLEKMKEALKTDVPGRFEELQEQQRVYEMLQTEISINQQTFNSIIAKV
LLFLESGEAEKRTEFISKLTLLKEQWQNVIWLVQQRKKDIDGLVSQWQLFRGSLQSLSRF
LADTNSFLTAVKSQNCYSLYHLRNLIHDFKSKAVILQRWQGMYSSIIDVGEKLRTDSDPE
TSAVLQEELSQLQQSWGDTQVQLEKMKTQLSSILQQSWDSCEKHTKELESRLRELKDEVK
DPLPVEHEELYKSKEHIKELEQSLADWAHNMKELQAMKAELAHCILTEDMMVLQEQVEHL
HRQWEELCLRVSLRKQEIEDRLNAWTVFNEKNKELCSWLVQMESKVLQTADVSIEDMIDK
LQKDCMEEINLFSENKLHLKQMGDQLIKASNKSRVAEIDDKLNKINDRWQHLFDVIGARV
KKLKETFAFIQLLDKNMSNLRTWLARIESELSKPVVYDICDDQEIQKRLAEQQDLQRDIE
QHTAGVESVFNICEVLLHDSDACANETECDSIQQTSRSLDRRWRNICAMSMERRMKIEET
WRLWQRFLDDYSRFEDWLKSAERTAASPNSSEVLYTHAKEELKKFEAFQRQIHERLTQLE
LINKQYRRLARENRTDSASKLKQMVHEGNQRWDNLQKRVAAILRRLKHFTNRRDEFEATR
ENILVWLTEMDLQLTNVEHFSKSNFDDKMRQLNGFQQEITLHTNKIDQLIVFGEQLIQKS
EPLDAILIEDELEELHRYCQEVFGRVARFHQRLTSRHPGLDDEKETSENETDPEDSREIQ
NDPWHKKAISEGPSSPQSLCHLMPPTQGHERSGCETPTPVSVDSIPLEWDHTGDVGGSSS
HEDEEEATYYSALSGKTVSEAHPWHSPESPVCRKHRYNQAEIVGDVLSGPETSTPYKPGY
VKQLSSASSSSVNKENITSANMSDEEPQDDQELVTITAAEKQSGIIDRWELIQAQDLRNK
LRIKQHLQQWQQVNSDLSDVSAWLDKTEEELEELQKAKPPASMQAMEQRVKKLKDTLKAF
DNYKAVVLSVNLSSKEFQKADSTEFKELQNRLRKVNLRWEKATHSLDNWRKGLRQALLHC
QDFHDQSQKLILWLASAEGRRNEAQITDPNADPHTILESQKELMQLEKELLEQQLKVNCL
QELSAYLLLKSDGEDYIEADEKVHVIGKKLKQLIEQVSHDLKSLQGSLDSRVFLPVPDDL
DSEVYHPVAVKSSPPVKKMTIRRTSDGRKNSNTRAESHAQPTHVVPRSPSFFYRVLRAAL
PLQLFFLLLLLLACMIPSSEEDYSCTQANNFARSFYPMLRYTNGPPPT
Download sequence
Identical sequences G1NLB5
ENSMGAP00000014297 ENSMGAP00000014297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]