SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014363 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014363
Domain Number 1 Region: 1074-1237
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 2.88e-35
Family Outer arm dynein light chain 1 0.00022
Further Details:      
 
Domain Number 2 Region: 763-948
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 1.18e-32
Family Outer arm dynein light chain 1 0.0009
Further Details:      
 
Domain Number 3 Region: 557-709
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 1.83e-27
Family Outer arm dynein light chain 1 0.0023
Further Details:      
 
Domain Number 4 Region: 3-100
Classification Level Classification E-value
Superfamily L domain-like 0.000000000000105
Family U2A'-like 0.042
Further Details:      
 
Domain Number 5 Region: 965-1031
Classification Level Classification E-value
Superfamily L domain-like 0.000000952
Family Leucine rich effector protein YopM 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014363   Gene: ENSMGAG00000013584   Transcript: ENSMGAT00000015294
Sequence length 1239
Comment pep:known_by_projection chromosome:UMD2:5:57033252:57064489:-1 gene:ENSMGAG00000013584 transcript:ENSMGAT00000015294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGLHTLQNLQEVNFAGNLITKIGSCFDFNTKIEKLNLSHNKLSSFKELTNLSRLPNLKDL
ALNDPLYGPNPVCLLSNYAIHVLYHIPRLQRLDMDDVSQKHIKSLAETTIMKKITYYHMH
VKSVQRQLHGKLEELKEKKSRLQSLPETKIKLFSSNIKQLECELDKMEMLDKTASSESQR
RRNLATENSVYDIEDAEKACLKNAFVQKINAMKERITFWNRKLDEIEKDCQTEMKKKKKS
FNLLVQFLLLELETVGNIHVEEGLSNSLWFSSCCDLIQSRFCSRDFRAYDIIGVKINRAF
RVHNQILRLKFEEKLQTFLEKETFSVAENYKEKMEYLFYVFNPEWSVKEKQLLQILEDGF
HDMETRVQPGKNEAVLLCNSLNICECPRIEFLKQQAKAEGNNRSDPEESFRHDLGTVIIA
KVFLGHSAPVCPMNPICQDNYPEANSVFRPWKCLERGASPSDNVSSTLEMWASWEQRNCD
SNGWQCEWFVFDHGLVLPEYIADLEYITLVRPLFFLDLPSSGLTRDISHDLQRDDEVLNM
EPSVEVRPKMTCLDDVKILSVAKANIYSQLQVLNLHGNRLKKLQNISRFKTLRKLIISFN
DFASLNDIYDLPNLEYLDASHNHVITLEGIRGLSKLQFFDLSWNQLKESKEVINILCEHT
PNLQSLDIRHNPWCKPTCIRLSVIGQLKTLTNLDGVLIADEEAAEALYYIEASVINQTSL
LEYSRTDEEKPPILSVFSCATILSQISKNRVDLQMDHNWYSMITVLNLDDQHLFKISNLE
KLEHLRWASFSNNNLTQVEGLESCLNLEELTLDENCISTLDGISKLTKLTRLSVNNNHLT
SLRRHVFENLSHLHYISVENNRITSLVGLKKTYSLIELYISYNCISMSQEIYHLKGLTNL
IILDMSGNGIVWKQDNYRLFVLFHLPSLNALDGISVEPAEGECAKDLFGGKLTSDMIADR
LGHSDFTEMQELNWANSDIRAVELVPADQFRSVNSVNLQNNNLTSFSGLIFLPNVKVLCL
NYNHIESILPGQKSANELTNRQQLHRKVISSGYGQQEYTKGRRDAGFEENLPPIMQSLEV
LHLGHNGITDMAYLQLSRLKNLKFLFLQGNFISQIEGLEGLQFLQELVLDHNRIKRISQG
SLAGQSGLQTLDLEKNHIRELNGLKPLVKLQKLFLQFNRIQELSELEKLQVIPGLKVLSL
HGNPVYLKKNYRSLLVIQLPALQVLDGIAVNAEERVKAE
Download sequence
Identical sequences G1NLG7
ENSMGAP00000014363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]