SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014619 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014619
Domain Number 1 Region: 36-291
Classification Level Classification E-value
Superfamily L domain-like 1.74e-46
Family Ngr ectodomain-like 0.032
Further Details:      
 
Domain Number 2 Region: 284-379
Classification Level Classification E-value
Superfamily Immunoglobulin 1.9e-18
Family I set domains 0.025
Further Details:      
 
Domain Number 3 Region: 421-496
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000611
Family Fibronectin type III 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014619   Gene: ENSMGAG00000013827   Transcript: ENSMGAT00000015556
Sequence length 535
Comment pep:known_by_projection chromosome:UMD2:5:62518488:62520706:-1 gene:ENSMGAG00000013827 transcript:ENSMGAT00000015556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLLLFLLFIGIAVRAQICPKRCVCQILSPNLATLCAKKGLLFVPPNIDRRTVELRLAD
NFVTNIKRKDFANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFS
GLSNLHHLILNNNQLTLISSTAFDDVLALEELDLSYNNLETIPWDAVEKMVSLHTLSLDH
NMIDHIPKGTFSHLHKMTRLDVTSNKLQKLPPDPLFQRAQVLATSGIISPSTFALSFGGN
PLHCNCELLWLRRLSREDDLETCASPQLLSGRYFWSIPEEEFLCEPPLITRHTHELRVLE
GQRAALRCKARGDPEPAIHWISPEGKLISNATRSVVYDNGTLDILITTVKDTGSFTCIAS
NPAGEATQTVDLHIIKLPHLLNSTNHIHEPDPGSSDISTSTKSGSNASSSNGDTKVSQDK
KVVVAEATSSTALLKFNFQRNIPGIRMFQIQYNGTYDDSLVYRMIPPTSKTFLVNNLAAG
TMYDLCVLAIYDDGITSLTATRVVGCTQFTTEQDYVRCHFMQSQFLGGTMIIIIG
Download sequence
Identical sequences G1NM35
ENSMGAP00000014619 ENSMGAP00000014619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]