SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014892 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014892
Domain Number 1 Region: 12-60
Classification Level Classification E-value
Superfamily L domain-like 0.000000522
Family Ngr ectodomain-like 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000014892
Domain Number - Region: 98-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.023
Family EGF-type module 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014892   Gene: ENSMGAG00000014077   Transcript: ENSMGAT00000015833
Sequence length 168
Comment pep:known_by_projection scaffold:UMD2:GL427266.1:567:1569:-1 gene:ENSMGAG00000014077 transcript:ENSMGAT00000015833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRILGTGHGEVWLDLSNCSLQTLPSAFSEAAAAVVLDLTENPLPALPAGSFLGFTQLQQL
AVPLAVPCPGGSGAWEEVTTYGSSCLCRGQRNPCNGSEELVPLCPENAACAPDGPGLSQC
LCASPFHGYKCLRQDTFPVPLFCSVLGTVTAALSLALWGSQRRHAAGP
Download sequence
Identical sequences H9H1X5
ENSMGAP00000014892 ENSMGAP00000014892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]