SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015236 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015236
Domain Number 1 Region: 8-204
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-46
Family Calponin-homology domain, CH-domain 0.0000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015236   Gene: ENSMGAG00000014399   Transcript: ENSMGAT00000016185
Sequence length 207
Comment pep:known_by_projection chromosome:UMD2:1:92816569:92827148:1 gene:ENSMGAG00000014399 transcript:ENSMGAT00000016185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSSALVPEMANRGPSYGLSREVQEKIEQKYDPELESRLANWIIVQCEEQIEPPPPGRQHF
QTWLMDGTLLCKLINSLHPKGNEPIAKISESKMAFKQMEQISQFLKAAEIYGVRTTDIFQ
TVDLWEGKDMAAVQRTLMALGSLAVTKDDGCYKGDPSWFHRKAQQNRRGFSEEQLRQGQN
VIGLQMGSNKGASQSGMTGYGMPRQII
Download sequence
Identical sequences G1NNK7
ENSMGAP00000015236 ENSMGAP00000015236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]