SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015501 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015501
Domain Number 1 Region: 204-294
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000742
Family Calponin-homology domain, CH-domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015501   Gene: ENSMGAG00000014633   Transcript: ENSMGAT00000016458
Sequence length 303
Comment pep:known_by_projection chromosome:UMD2:1:120669831:120692853:1 gene:ENSMGAG00000014633 transcript:ENSMGAT00000016458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WFTLFGWSKGPNPVSIPHSLRRDVCKVEMTSSLEKVFQQNLEKDTIYDMLFHLSGQLLPG
ITLNRSLPLDPVERMIHLYWQHSTLLTFLKSRGASLPHVMPEYLFEPDDYKKWTKMQAEL
QNNPTIVTVLYCVNISNKQLLILEDSVFEMISKQAWTDVLLQVYKVFVLPRVSSHNTADV
INLENMQNVPRINSELLSSNIYSPYERIILTWLNKNYENNRKTVWKDGQKGKIPLMRWIV
NFDRDLLDGLVLAAQMAAYCPFLIASHFVRMYTYPRTPAHFLHNCLILVNAMHAVSLTIN
IKV
Download sequence
Identical sequences G1NP62
ENSMGAP00000015501 ENSMGAP00000015501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]