SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015503 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015503
Domain Number 1 Region: 4-186
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.8e-66
Family Calponin-homology domain, CH-domain 0.00000378
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015503   Gene: ENSMGAG00000014635   Transcript: ENSMGAT00000016460
Sequence length 190
Comment pep:novel chromosome:UMD2:1:121881074:121906831:1 gene:ENSMGAG00000014635 transcript:ENSMGAT00000016460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRRCIEDLFNDFRDGRKLLELLECLTGQKIAKEKGSTRVHALNNVNKALHILQRNNVDLV
NIGSSDIVDGNHKLTLGLIWNIILHWQVKDVMKNIMAGLQQTNSEKILLSWVRQSTRNYP
QVNVINFTSSWSDGLAFNALLHSHRPDLFDWNVVASQQSPVQRLDHAFNIARQHLGIEKL
LDPEDFGVHI
Download sequence
Identical sequences G1NP64
ENSMGAP00000015503 ENSMGAP00000015503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]