SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015907 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015907
Domain Number 1 Region: 4-173
Classification Level Classification E-value
Superfamily L domain-like 1.21e-24
Family Ngr ectodomain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015907   Gene: ENSMGAG00000014999   Transcript: ENSMGAT00000016871
Sequence length 232
Comment pep:known_by_projection chromosome:UMD2:1:176684428:176689149:1 gene:ENSMGAG00000014999 transcript:ENSMGAT00000016871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YFLFHLPDLTPLMDTLVCLNLSFNNLLFFPMEVFNIKSLQVLVLRSNPIRKIPNDIHRLK
SLKKFTISFNLLAELPSGLFLLDDLWYLDIAYNYISYIPNDIKNLRKLEYLNTEGNQLSA
LPCGVLNLPLKSLRIENNFIHPLLWNEKIQSQPQKLIHLAALCFSTNNLKERYNNITEDI
KKILDDFSVCDCCSGPRYGKGLQLIQMYRNVFKFGRLPFYFYACSPSCHRNF
Download sequence
Identical sequences G1NQ45
ENSMGAP00000015907 ENSMGAP00000015907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]