SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015929 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015929
Domain Number 1 Region: 2-200
Classification Level Classification E-value
Superfamily L domain-like 4.15e-38
Family Ngr ectodomain-like 0.054
Further Details:      
 
Domain Number 2 Region: 474-587
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-28
Family Calponin-homology domain, CH-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015929   Gene: ENSMGAG00000015023   Transcript: ENSMGAT00000016895
Sequence length 592
Comment pep:known_by_projection chromosome:UMD2:1:176841615:176903742:1 gene:ENSMGAG00000015023 transcript:ENSMGAT00000016895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDLSKNRLTEIPTELCHFVSLETLNLYHNCIKIIPDAIVNLRMLTYLNLSRNQLSSLPAC
LCGLPLKVLIASNNKLGSLPEEIGQLKQLMELDVSCNEITTLPQQIGLLKSLKELNVRRN
YLEVLPQELVQLPLVKFDFSCNKVLVIPICFRKMAQLQVLLLENNPLQSPPAQICTKGKV
HIFKYLTVQACQIKTADSLYLNAIEQPHLPQPVEESKKDSDSGVGSDNGDKRLSATEPSD
EDTISFNVPMSDIVEEDQVVKEDSGHHANSRKVEFHQGSSHLIVNDKSRETGIRLDESDA
LTTEFMSYIKSRAAECDELLRIEEDAQWQTEEIINMSEEQTIDIAMIEQLREAVDLLQDP
NRLSMDISESSDVNLYPMEPATALEFQESTVNSQMQMEMSSLGQLNNDVIVWNTSGQPSP
NENKDKSPTLSPTTNNTIPFGLKPRSVFLRPQRNLESIDPQFTIRRKMEQMREERELVEQ
LRENIETRLKICLPEDLGSALMDGVVLCHLVNHIRPRSVGSIHVPSPAVPKLSMAKCRRN
VENFLDACRKLGIPEEKLCLPHHILEEKGLVKVSITVQALLDVTTVKQALFT
Download sequence
Identical sequences G1NQ64
ENSMGAP00000015929 ENSMGAP00000015929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]