SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000016237 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000016237
Domain Number 1 Region: 1-143
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.4e-50
Family G proteins 0.000000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000016237   Gene: ENSMGAG00000015298   Transcript: ENSMGAT00000017210
Sequence length 143
Comment pep:known_by_projection chromosome:UMD2:1:203385846:203394372:-1 gene:ENSMGAG00000015298 transcript:ENSMGAT00000017210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYI
RDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGER
KAKELNVMFIETSAKAGYNVKQV
Download sequence
Identical sequences A0A091ECR5 A0A091H421 G1NQW0
ENSMGAP00000016237 ENSMGAP00000016237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]